SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898874|ref|NP_343479.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898874|ref|NP_343479.1|
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000152
Family Middle operon regulator, Mor 0.056
Further Details:      
 
Weak hits

Sequence:  gi|15898874|ref|NP_343479.1|
Domain Number - Region: 216-293
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00354
Family Retroviral integrase, catalytic domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898874|ref|NP_343479.1|
Sequence length 337
Comment transposase ISC1078 [Sulfolobus solfataricus P2]
Sequence
MPKSRMHGIRLNKKQEEERRINAVKDVRNGMSIKDVAKKYDVSIFTVYKWLRKGDLSAKP
RKGPTKLKDEEKLVRILEKSPRDFGLNYDFWTLKLIAYILDKEFGIKYNPRSLSPVLKKL
GFKYKKGKRTYVRDDNAVERWVKEQGEKLFKKIREGYKVHIFDESYVSYINKGKGWMKVG
GGIKVNPKRKRFAVVGGITISKEGITFSYSTYKKPSLNSKDIILYLRKVIKDEKTVIVMD
NARIHGNEVREFLEENGVEFVYLPPYSPDKSPAEGPWAVLKKRLYSKIYTDFETLMWDAT
RFLRSISKRVNDLTYSVKRCGEPWTSILSEVFLPFKV
Download sequence
Identical sequences D0KNN2 P95906 Q7LX66
gi|15898692|ref|NP_343297.1| gi|15898874|ref|NP_343479.1| gi|15898916|ref|NP_343521.1| gi|384432895|ref|YP_005642253.1| gi|384435007|ref|YP_005644365.1| 273057.SSO1897 273057.SSO2090 273057.SSO2132 SsT59 WP_010923639.1.14611 WP_010923639.1.22626 WP_010923639.1.43719 WP_010923639.1.66040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]