SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898877|ref|NP_343482.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898877|ref|NP_343482.1|
Domain Number 1 Region: 87-490
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.62e-107
Family Amylase, catalytic domain 0.00000000000449
Further Details:      
 
Domain Number 2 Region: 494-560
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.94e-26
Family alpha-Amylases, C-terminal beta-sheet domain 0.00011
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily E set domains 7.52e-20
Family E-set domains of sugar-utilizing enzymes 0.0000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898877|ref|NP_343482.1|
Sequence length 561
Comment maltooligosyltrehalose trehalohydrolase TreZ [Sulfolobus solfataricus P2]
Sequence
MTFGYKLDEDGVTFNLWAPYQRKVKLKILNRGIYEMERDDKGYFTITLDNVRVGDRYKYI
LDDNSEVPDPASRYQPEGVHGYSEIISPDFEWDDENSVKVKREDLVIYELHIGTFTSEGT
FEGVIKKLNYLKELGVTAIEIMPIAQFPGKKDWGYDGVYLYAVQNSYGGPSGFRKLVNEA
HKLGLAVILDVVYNHVGPEGNYMVKLGPYFSEKYKTPWGLTFNFDDAGSDEVRKFILENV
EYWINEFHVDGFRLDAVHAIIDNSPKHILEDIADVVHKYDKIVIAESDLNDPRVVNPKEK
CGYNIDAQWVDDFHHAIHAFLTGERQGYYSDFGSIGDIVKSYKDVFIYDGKYSNFRRKTH
GKSVGDLDGCKFVVYIQNHDQVGNRGGGERLIKLVDKESYKIAAALYILSPYIPMIFMGE
EYGEENPFYYFSDFSDPKLIQGVREGRRRENGQETDPQSDCTFNDSKLSWKINDDILSFY
KSLIKIRKEYGLACNRKLSVENGNYWLTVKGNGCLAVYVFSKSVIEMKYSGTLVLSSNSS
FPSQITESKYELDKGFALYKL
Download sequence
Identical sequences A0A0E3KD25 D0KPY3 P95867
WP_009989788.1.14611 WP_009989788.1.22626 WP_009989788.1.43719 WP_009989788.1.57434 WP_009989788.1.66040 WP_009989788.1.8449 WP_009989788.1.93834 gi|384435130|ref|YP_005644488.1| 273057.SSO2093 gi|15898877|ref|NP_343482.1| NYSGRC-FDAO-15898877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]