SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898878|ref|NP_343483.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898878|ref|NP_343483.1|
Domain Number 1 Region: 150-491,520-596
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.69e-132
Family Amylase, catalytic domain 0.000000459
Further Details:      
 
Domain Number 2 Region: 14-160
Classification Level Classification E-value
Superfamily E set domains 5.28e-45
Family E-set domains of sugar-utilizing enzymes 0.0015
Further Details:      
 
Domain Number 3 Region: 610-714
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000142
Family alpha-Amylases, C-terminal beta-sheet domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898878|ref|NP_343483.1|
Sequence length 718
Comment glycogen debranching protein TreX [Sulfolobus solfataricus P2]
Sequence
MALFFRTRDRPLRPGDPYPLGSNWIEDDDGVNFSLFSENAEKVELLLYSLTNQKYPKEII
EVKNKTGDIWHVFVPGLRPGQLYAYRVYGPYKPELGLRFNPNKVLIDPYAKAINGSVIWN
DAVFGYKIGDQNQDLTYDERDSGEYVPKSVVINPYFEWDDEDFIKGKKVPLKDTVIYEVH
VKGFTKLRLDLPENIRGTYEGLASEQMISYLKDLGITTVELMPVFHFIDQRFLTDKGLTN
YWGYDPINFFSPECRYSSTGCLGGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNHLGP
TLSFRGIDNTAYYMLQPDNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGF
RFDLAAALARELYSVNMLNTFFIALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEW
NGKYRDSIRRFWRGEALPYSEIANRLLGSPDIYLGNNKTPFASINYVTSHDGFTLEDLVS
YNQKHNEANGFNNQDGMNENYSWNCGAEGPTNDQNVVICREKQKRNFMITLLVSQGTPMI
LGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSKFLEFVKKMIQFYRAHPAFRRERYF
QGKKLFGMPLKDVTFYTLEGREVDEKTWSSPTQLVIFVLEGSVMDEINMYGERIADDSFL
IILNANPNNVKVKFPKGKWELVISSYLREIKPEERIIEGEKELEIEGRTALVYRRIEL
Download sequence
Identical sequences D0KPY4 P95868 Q7LX99
273057.SSO2094 gi|384435131|ref|YP_005644489.1| WP_009989784.1.14611 WP_009989784.1.22626 WP_009989784.1.43719 WP_009989784.1.57434 WP_009989784.1.66040 WP_009989784.1.8449 WP_009989784.1.93834 2vnc_A 2vnc_B 2vr5_A 2vr5_B 2vuy_A 2vuy_B gi|15898878|ref|NP_343483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]