SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898992|ref|NP_343597.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898992|ref|NP_343597.1|
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000025
Family PIN domain 0.025
Further Details:      
 
Weak hits

Sequence:  gi|15898992|ref|NP_343597.1|
Domain Number - Region: 126-154
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.000288
Family RBP12 subunit of RNA polymerase II 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898992|ref|NP_343597.1|
Sequence length 158
Comment hypothetical protein SSO2218 [Sulfolobus solfataricus P2]
Sequence
MHIIFDTSGFLSGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAISSGKVIIMKPSTRSVE
KVTKVLNLTKERKLSNTDISVIALALDLQPSIVFTDDLSVQNILKQLGIQFSSVKINKKV
EKSFKFKYVCVNCKREFNIDHGECPYCGGKVVKRRIME
Download sequence
Identical sequences A0A0E3K7D1 D0KMW8 Q97WJ9
gi|384432584|ref|YP_005641942.1| gi|15898992|ref|NP_343597.1| SsR93 273057.SSO2218 WP_009992064.1.14611 WP_009992064.1.22626 WP_009992064.1.43719 WP_009992064.1.57434 WP_009992064.1.66040 WP_009992064.1.8449 WP_009992064.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]