SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899048|ref|NP_343653.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899048|ref|NP_343653.1|
Domain Number 1 Region: 61-281
Classification Level Classification E-value
Superfamily SIS domain 2.09e-30
Family double-SIS domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899048|ref|NP_343653.1|
Sequence length 296
Comment bifunctional phosphoglucose/phosphomannose isomerase [Sulfolobus solfataricus P2]
Sequence
MDEIYLNWDKMFDEAFRIPIHEIKNDNIVFSGIGGSGIVGEIANILGVELSFKRKFTGKE
SLIAVSYSGTTSETINDVENAVKAGSEVIIITSGGILEKLAKEKSLKLIKIPSGFQTRYA
FPYLFTPLIKMTTKRRGIKINEMELKEGVIEAKEQIKADATRLAELLINRIPVIYSSKYL
AIAKRFKQEINENAKHPAFYGEIPEINHNEIESYVHGPSLVSVIVESSEIDKITEDVLNS
IVIKPYFNSDEKNISSLLALAGVTSLEMAKKLNEKPDKLYNIPKARQLTSNLFKIN
Download sequence
Identical sequences A0A0E3MAW2 D0KUS8 Q97WE5
WP_009991835.1.14611 WP_009991835.1.22626 WP_009991835.1.43719 WP_009991835.1.57434 WP_009991835.1.66040 WP_009991835.1.8449 WP_009991835.1.93834 273057.SSO2281 gi|15899048|ref|NP_343653.1| gi|384432642|ref|YP_005642000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]