SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899099|ref|NP_343704.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899099|ref|NP_343704.1|
Domain Number 1 Region: 10-270
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 1.28e-120
Family Purine and uridine phosphorylases 0.0000000977
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899099|ref|NP_343704.1|
Sequence length 270
Comment 5'-methylthioadenosine phosphorylase [Sulfolobus solfataricus P2]
Sequence
MIEQNEKASIGIIGGSGLYDPGIFSESKEIKVYTPYGQPSDFITIGKIGNKSVAFLPRHG
RGHRIPPHKINYRANIWALKELGVRWVISVSAVGSLRMDYKLGDFVIPDQFIDMTKNREY
SFFDGPVVAHVSMADPFCNSLRKLAIETAKELNIKTHESGTYICIEGPRFSTRAESRTWR
EVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVFAEIPVTAEEVTRVMAENTEKAK
KLLYALIQKLPEKPEEGSCSCCNSLKTALV
Download sequence
Identical sequences A0A0E3JSQ3 Q97W94
000144409|e3t94A1|2011.3.1.3|A:1-270 000160128|e2a8yA1|2011.3.1.3|A:1-270 000297473|e2a8yB1|2011.3.1.3|B:1-270 000297474|e2a8yC1|2011.3.1.3|C:1-270 000297475|e2a8yD1|2011.3.1.3|D:1-270 000297476|e2a8yE1|2011.3.1.3|E:1-270 000297477|e2a8yF1|2011.3.1.3|F:1-270 000297478|e2a8yG1|2011.3.1.3|G:1-270 000297479|e2a8yH1|2011.3.1.3|H:1-270 000297480|e2a8yI1|2011.3.1.3|I:1-270 000297481|e2a8yJ1|2011.3.1.3|J:1-270 000297482|e2a8yK1|2011.3.1.3|K:1-270 000297483|e2a8yL1|2011.3.1.3|L:1-270 000427882|e3t94B1|2011.3.1.3|B:1-270 000427883|e3t94C1|2011.3.1.3|C:1-270 000427884|e3t94D1|2011.3.1.3|D:1-270 000427885|e3t94E1|2011.3.1.3|E:1-270 000427886|e3t94F1|2011.3.1.3|F:1-270 cath|current|2a8yA00/1-270 cath|current|2a8yB00/1-270 cath|current|2a8yC00/1-270 cath|current|2a8yD00/1-270 cath|current|2a8yE00/1-270 cath|current|2a8yF00/1-270 cath|current|2a8yG00/1-270 cath|current|2a8yH00/1-270 cath|current|2a8yI00/1-270 cath|current|2a8yJ00/1-270 cath|current|2a8yK00/1-270 cath|current|2a8yL00/1-270 cath|current|3t94A00/1-270 cath|current|3t94B00/1-270 cath|current|3t94C00/1-270 cath|current|3t94D00/1-270 cath|current|3t94E00/1-270 cath|current|3t94F00/1-270 d2a8ya_ d2a8yb_ d2a8yc_ d2a8yd_ d2a8ye_ d2a8yf_ d2a8yg_ d2a8yh_ d2a8yi_ d2a8yj_ d2a8yk_ d2a8yl_ d3t94a_ d3t94b_ d3t94c_ d3t94d_ d3t94e_ d3t94f_ gi|15899099|ref|NP_343704.1| 355635 WP_009989516.1.22626 WP_009989516.1.43719 WP_009989516.1.57434 WP_009989516.1.66040 WP_009989516.1.8449 WP_009989516.1.93834 273057.SSO2343 2a8y_A 2a8y_B 2a8y_C 2a8y_D 2a8y_E 2a8y_F 2a8y_G 2a8y_H 2a8y_I 2a8y_J 2a8y_K 2a8y_L 3t94_A 3t94_B 3t94_C 3t94_D 3t94_E 3t94_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]