SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899109|ref|NP_343714.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15899109|ref|NP_343714.1|
Domain Number - Region: 2-89
Classification Level Classification E-value
Superfamily PH0156-like 0.00458
Family PH0156-like 0.018
Further Details:      
 
Domain Number - Region: 74-119
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0458
Family V-type ATPase subunit E 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899109|ref|NP_343714.1|
Sequence length 127
Comment hypothetical protein SSO2352 [Sulfolobus solfataricus P2]
Sequence
MQLENKPIIVISSTNSEEIPNFVRAMFKDCRLNGSKKLVINFVSSISYPEFVQNAREALL
DNIDLGVYIYIWKPEEVDQMMRRIMENHKDMKGMIIYCDDNNKHMIEKILPKIPNSIKAN
IIKDYCK
Download sequence
Identical sequences A0A0E3MHE2 D0KUZ0 Q97W84
gi|384432704|ref|YP_005642062.1| WP_009989501.1.14611 WP_009989501.1.22626 WP_009989501.1.43719 WP_009989501.1.57434 WP_009989501.1.66040 WP_009989501.1.8449 WP_009989501.1.93834 gi|15899109|ref|NP_343714.1| 273057.SSO2352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]