SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899123|ref|NP_343728.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899123|ref|NP_343728.1|
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-32
Family GHMP Kinase, N-terminal domain 0.0000611
Further Details:      
 
Domain Number 2 Region: 168-289
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8.92e-25
Family Homoserine kinase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15899123|ref|NP_343728.1|
Sequence length 311
Comment homoserine kinase [Sulfolobus solfataricus P2]
Sequence
MECKRARAYSSSANLGSGFDILSIAHTAFFDTVEICVENKNLNNIIVESNSKIPLEPNKN
SATYPIVKIMEEIGIKASLKVRVIKGIPEGLGLGSSGASAAAAVMAFNNLFNLNLSKEDL
VRYAMYGEIASSGSPHPDNVAASVFGGVVSVVSVSPVKVVEIPINYSFDILLFTPLNVHI
EEKTKKAREMVPKTVTLSDYINNSRYISSLLLGFIKGERELIRLGLNDKIVEKARLPLFP
YYPKIKEVAIKYDAIGACVSGAGPSILVLTDKMTDENKIVEEGTKTCNEFNVECKVIKAK
IAGGVGIEGRD
Download sequence
Identical sequences A0A0E3K7I5 D0KV04 Q97W70
273057.SSO2367 gi|15899123|ref|NP_343728.1| gi|384432718|ref|YP_005642076.1| WP_009989478.1.14611 WP_009989478.1.22626 WP_009989478.1.43719 WP_009989478.1.57434 WP_009989478.1.66040 WP_009989478.1.8449 WP_009989478.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]