SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899143|ref|NP_343748.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899143|ref|NP_343748.1|
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.96e-68
Family Inorganic pyrophosphatase 0.000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899143|ref|NP_343748.1|
Sequence length 172
Comment inorganic pyrophosphatase [Sulfolobus solfataricus P2]
Sequence
MKLGPGKKAPDEINVFIEIPMGSNIKYEYDEEEDIIKVDRVLYTSMVYPFNYGFIPETLE
EDGDPLDVLVLGNYSLMPGTVIEARPIGMIYMRDEEGEDAKVIAVPRNKTDPSFSNINDV
KDLPEAIRNKIVHFFEHYKELEPNKWVKISGWGSVAEAKERIKKAIERKKQG
Download sequence
Identical sequences A0A0E3MBR2 D0KV23 Q97W51
gi|384432737|ref|YP_005642095.1| 273057.SSO2390 gi|15899143|ref|NP_343748.1| WP_009989450.1.14611 WP_009989450.1.22626 WP_009989450.1.43719 WP_009989450.1.57434 WP_009989450.1.66040 WP_009989450.1.8449 WP_009989450.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]