SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899148|ref|NP_343753.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899148|ref|NP_343753.1|
Domain Number 1 Region: 301-375
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.000000000000068
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.045
Further Details:      
 
Domain Number 2 Region: 73-126
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000103
Family FAD-linked oxidases, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899148|ref|NP_343753.1|
Sequence length 751
Comment Iron-sulfur protein [Sulfolobus solfataricus P2]
Sequence
MILDASIFSRAVIGGYDVKKIESNDKNELVVGRLTGLYGDVLKYTNLKIIRAPDRFDDGS
VFREVEGKNIYKIFEVPAGVTFDKLIDELSKINYYPAIFPLYLKGTIGGFTASNGSGFGS
YKFGFAKGKKTINELIDYKVVRVLAVKYPELLETEGENRFAWSALIYKDTTRYYIPSFYN
KVIKGNFKSVSINNLIKSINMEISSIFKRNYVPIILMTNYDKNVEFNFDFKMGYIINYNS
PRKYKVMIGSLEETRLPELFEFLRKNPDILPFPYLKEYEEFHKDIIRNFKKYEIKIRSKR
INKNTIVEASKCINCSLCLDSCLAYNTTNNILYSPLGRFNRLLTGEGNFEFCFGCASCQE
ACPVGINISNLMEILPQFNEKKETIELETIDVPRTIYELEKNLGSRYRNRPVFLLFVGCA
AKYDPLGLEGFLNYLLINGDKLPQELSPRVRLVTGICCGFNDYLAGNLEGARNSVEKINR
LRIEQNAAGIYFLCPEGLYIYNKFSEQKGIFAYEVIKHELKDKEVHLGCWAKKLGYSSQY
NECAGLFLTSYKGSPIRATKKGFLTVCPFSTWKFGTISAYSLFLEKKEVKYLEEEKVMIN
ENIIFDLLVRAVADGLIASKDEIAEKVVMWSLGGSQYFLLLTIPIFSKYISSELIRKLSS
DSRVKEFLSKLSQDTPLLNQKISTYKDYLSYYNFSNEINTLRDEIAKSNKLDYSVRDLVK
TSEFLNVLKEALRRSINENLIGNAINNIIYL
Download sequence
Identical sequences A0A0E3KA21 Q97W47
WP_009989442.1.14611 WP_009989442.1.22626 WP_009989442.1.43719 WP_009989442.1.57434 WP_009989442.1.66040 WP_009989442.1.8449 WP_009989442.1.93834 273057.SSO2398 gi|15899148|ref|NP_343753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]