SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899185|ref|NP_343790.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899185|ref|NP_343790.1|
Domain Number 1 Region: 16-213
Classification Level Classification E-value
Superfamily SIS domain 7.99e-28
Family mono-SIS domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899185|ref|NP_343790.1|
Sequence length 275
Comment hypothetical protein SSO2437 [Sulfolobus solfataricus P2]
Sequence
MYADLIEREITQDYKVNLDLKLDNAYIAGAGDSYAVALTIEGKTNGRFKALDPFEGLHYE
NLDRPLVIVSVSGRPKSNILLATKFKGKTRLYVITANEDSQLARLADYLILIPYKPIIPL
PGTLSFLMSLSAVYSLAGEQADEIKESGRLLNLANNPFFVGHKENYGIAYYAMLKFAEIF
GYATNSERFEQFCHSPIFMTANRQIVLFRSDNEREKELINSIDYTDTQATDCSGAFCNSI
ILIKSIVNKMRKEKWDKIYFLENKKILNISSKMIY
Download sequence
Identical sequences A0A0E3JVY2 D0KN04 Q97W10
273057.SSO2437 gi|15899185|ref|NP_343790.1| WP_010923854.1.14611 WP_010923854.1.22626 WP_010923854.1.43719 WP_010923854.1.8449 WP_010923854.1.93834 gi|384432782|ref|YP_005642140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]