SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899208|ref|NP_343813.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899208|ref|NP_343813.1|
Domain Number 1 Region: 112-185
Classification Level Classification E-value
Superfamily Single hybrid motif 2.36e-21
Family Biotinyl/lipoyl-carrier proteins and domains 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899208|ref|NP_343813.1|
Sequence length 186
Comment biotin carboxyl carrier protein of propionyl-CoA carboxylase subunit beta [Sulfolobus solfataricus P2]
Sequence
MENLWYHIPILSKGVVVMRLFRLYSELGDMYLVSYEQSNNSLDKIKIGDKNYEVKYLGSG
NRENEYLFEINGKKYYVFIESDGTLIFNHQDFLRLDKVTEIPIKGEERVEEIIRGKEGEI
VSPLFGRVVKIRVKEGDAVNKGQPLLSIEAMKAETVISSPIGGIVQKILIKEGQGVKKGD
ILIVIK
Download sequence
Identical sequences Q97VY7
354092 APC66795.0 gi|15899208|ref|NP_343813.1| 273057.SSO2464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]