SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899242|ref|NP_343847.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899242|ref|NP_343847.1|
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.69e-67
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000145
Further Details:      
 
Domain Number 2 Region: 252-462
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.65e-56
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899242|ref|NP_343847.1|
Sequence length 463
Comment 4-hydroxybutyryl-CoA dehydratase [Sulfolobus solfataricus P2]
Sequence
MRSKEDFLKSLKDGRNLYYRGKLVEDITTHQILKTAALHAAKLYEYADRVYEDNKMGKMS
KFFKVPWTSQDLLDRHKLIYDLTMYCNGVFNISQAIGSDAIFALMITAKQVDRKYGTDYS
KRVEKYFERVAKEDLTLATAQTDVKGDRSKRPSEQVDPDMYVRVVDVKSDGIVVRGAKAH
TTQSAVSDEIIVIPTRVMRDSDKDYAVAFAVPANTKGLKMYIRPIDEIEGNSSSVLSRKD
YELETLTVFNDVFVPWDRVFLFKEYDYAGTLAMLFATFHRFTALSYRSATMNLYLGASKV
ASQVNGIENEKHVRDDIVDIILYKEIMRSSAIAAAVYPVNMEGIAVPNPLFTNVGKLYSN
MHFHDVVRDLIDIAGGIIATMPSQEDLESDEGKNIVKYLRGSVDGEERAKVLKLAKELGA
STFTGYLLTGMIHAEGSMEASKIELFRSYNFKEAENLVKRVLS
Download sequence
Identical sequences C3MKV0 C3N9C8 C3NMZ6 D2PFC4 F0NE56 F0NJ81 M9U6P9 Q97VV3
gi|229578114|ref|YP_002836512.1| 273057.SSO2503 419942.YN1551_2902 429572.LS215_0322 439386.YG5714_0299 gi|385772320|ref|YP_005644886.1| gi|229583326|ref|YP_002841725.1| gi|15899242|ref|NP_343847.1| gi|479324713|ref|YP_007864761.1| gi|227829341|ref|YP_002831120.1| 356179 gi|284996700|ref|YP_003418467.1| WP_010923905.1.13477 WP_010923905.1.27011 WP_010923905.1.34992 WP_010923905.1.52267 WP_010923905.1.66823 WP_010923905.1.67233 WP_010923905.1.8449 WP_010923905.1.91160 gi|385775038|ref|YP_005647606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]