SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899244|ref|NP_343849.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899244|ref|NP_343849.1|
Domain Number 1 Region: 5-78
Classification Level Classification E-value
Superfamily Homeodomain-like 3.44e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0038
Further Details:      
 
Domain Number 2 Region: 99-195
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000741
Family Tetracyclin repressor-like, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15899244|ref|NP_343849.1|
Sequence length 198
Comment transcriptional regulator [Sulfolobus solfataricus P2]
Sequence
MVQMYRYPKTEKGKESLNKIINASLDLISEKGFLNTSISDITNKAGVAYGLFYFYFKSKH
DILDELIRKFNTDMRYYLKVNTMGIRNRIEMEKEGLAKFLEWMSQNKKYYKVFVEAQVHR
PEMYIWHFTKLAERYKIGLKEAMDRGEIVKVDPELLAYVLIGIGEMIGRRYILWTNQGLT
KKQYNDLAILIENMLRPK
Download sequence
Identical sequences A0A157T4B5 Q97VV1
399267 gi|15899244|ref|NP_343849.1| 273057.SSO2506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]