SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899249|ref|NP_343854.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899249|ref|NP_343854.1|
Domain Number 1 Region: 6-241
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 4.71e-70
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00039
Further Details:      
 
Domain Number 2 Region: 228-367
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.61e-18
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899249|ref|NP_343854.1|
Sequence length 370
Comment acyl-CoA dehydrogenase [Sulfolobus solfataricus P2]
Sequence
MSKNEDELEEYRIKVREWIRNNVPEEIRAKGDMAPPDVLREWQRRIYEAGYLGVSWPKEY
GGWGENPIKEIIVREEFAKAGVPYATVGLGVSVVGPAIILNGTEEQKKKHIRRILTAEDV
WCQGFSEPQAGSDLAGIKTKAEDKGEYFLVNGQKIWSSYAHLANYCLLLTRTGDVSERHK
GLTMLIVDMKSEGIRVSPIKQITGRSEFNTVYFNNVKVPKENVVGKIGEGWKVAMSTLNY
ERLNIGTILFTVERLIRELSINNDQLFNTAEEIVALKSFYKRILERLKKGYIAGPEAAVI
KLVASEAIQRVYENAMANMGIEGLVMEREPGFRPEIAYGFLASRSITIAGGTSEILRNLL
GEVVLGLPKG
Download sequence
Identical sequences A0A157T5N6 D0KN77 Q97VU6
WP_009988491.1.14611 WP_009988491.1.43719 WP_009988491.1.57434 WP_009988491.1.8449 gi|384432855|ref|YP_005642213.1| gi|15899249|ref|NP_343854.1| 273057.SSO2511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]