SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899321|ref|NP_343926.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899321|ref|NP_343926.1|
Domain Number 1 Region: 1-218
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 4.97e-46
Family Triosephosphate isomerase (TIM) 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899321|ref|NP_343926.1|
Sequence length 227
Comment triosephosphate isomerase [Sulfolobus solfataricus P2]
Sequence
MKPPIIIINFKAYENSFGDKAVNLGKKIEKISKEYSVEIILSTPATMIYRMSQEVDLPIY
AEHVDPVPLGAFTGAILPEMVKDAGAKGTLINHSERRLRADEIDDVLKRTKKLGLKSILC
VDRYELVYPFSLLKPDAILIEPPELIGTGVSVSKAKPEVITRAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALRAISS
Download sequence
Identical sequences A0A0E3GUG1 D0KNR4 Q97VM8
gi|384432927|ref|YP_005642285.1| WP_009989304.1.14611 WP_009989304.1.22626 WP_009989304.1.43719 WP_009989304.1.57434 WP_009989304.1.66040 WP_009989304.1.8449 WP_009989304.1.93834 273057.SSO2592 gi|15899321|ref|NP_343926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]