SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899423|ref|NP_344028.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899423|ref|NP_344028.1|
Domain Number 1 Region: 5-211
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 1.23e-78
Family Purine and uridine phosphorylases 0.0000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899423|ref|NP_344028.1|
Sequence length 236
Comment 5'-methylthioadenosine phosphorylase [Sulfolobus solfataricus P2]
Sequence
MNPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIA
THGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYL
RDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVE
MECATLFTLSKVKGWKSATVLVVSDNLAKGGIWITKEELEKSVMDGAKAVLDTLTS
Download sequence
Identical sequences A0A0E3MCR2 D0KPF5 P50389
gi|384433042|ref|YP_005642400.1| 273057.SSO2706 1jds_A 1jds_B 1jds_C 1jds_D 1jds_E 1jds_F 1jdt_A 1jdt_B 1jdt_C 1jdu_A 1jdu_B 1jdu_C 1jdv_A 1jdv_B 1jdv_C 1jdv_D 1jdv_E 1jdv_F 1jdz_A 1jdz_B 1jdz_C 1je0_A 1je0_B 1je0_C 1je1_A 1je1_B 1je1_C 1je1_D 1je1_E 1je1_F 1jp7_A 1jp7_B 1jp7_C 1jpv_A 1jpv_B 1jpv_C WP_009988635.1.14611 WP_009988635.1.22626 WP_009988635.1.43719 WP_009988635.1.57434 WP_009988635.1.66040 WP_009988635.1.8449 WP_009988635.1.93834 1je0A cath|current|1jdsA00/3-236 cath|current|1jdsB00/3-236 cath|current|1jdsC00/3-236 cath|current|1jdsD00/3-236 cath|current|1jdsE00/3-236 cath|current|1jdsF00/3-236 cath|current|1jdtA00/2-236 cath|current|1jdtB00/2-236 cath|current|1jdtC00/2-236 cath|current|1jduA00/3-236 cath|current|1jduB00/3-236 cath|current|1jduC00/3-236 cath|current|1jdvA00/2-236 cath|current|1jdvB00/2-236 cath|current|1jdvC00/2-236 cath|current|1jdvD00/2-236 cath|current|1jdvE00/2-236 cath|current|1jdvF00/2-236 cath|current|1jdzA00/3-236 cath|current|1jdzB00/3-236 cath|current|1jdzC00/3-236 cath|current|1je0A00/3-236 cath|current|1je0B00/3-236 cath|current|1je0C00/3-236 cath|current|1je1A00/3-236 cath|current|1je1B00/2-236 cath|current|1je1C00/2-236 cath|current|1je1D00/3-236 cath|current|1je1E00/2-236 cath|current|1je1F00/3-236 cath|current|1jp7A00/3-236 cath|current|1jp7B00/3-236 cath|current|1jp7C00/3-236 cath|current|1jpvA00/2-236 cath|current|1jpvB00/3-236 cath|current|1jpvC00/3-236 gi|15899423|ref|NP_344028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]