SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899452|ref|NP_344057.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899452|ref|NP_344057.1|
Domain Number 1 Region: 5-70
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000753
Family Myb/SANT domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899452|ref|NP_344057.1|
Sequence length 186
Comment hypothetical protein SSO2736 [Sulfolobus solfataricus P2]
Sequence
MELPGYDYIIVYKDIHFGRPFIAGTLIRPENVLYELAKDKTFDEVSKAFYNQINFKQIRE
CIKYAIDVMKILKYYKKVKPKVPRRLKRKLGPTNYTFIDKDDDNNSSKYDPKIKNSSTKV
VDVLNKLYEGKEISQVAEELNIPKEAVIESILYSASLVDDFHLSLSAFEDPASVVIESFN
YIRKKQ
Download sequence
Identical sequences A0A0E3MBB0 D0KPI0 Q97V98
273057.SSO2736 WP_009990280.1.14611 WP_009990280.1.22626 WP_009990280.1.43719 WP_009990280.1.57434 WP_009990280.1.66040 WP_009990280.1.8449 WP_009990280.1.93834 gi|15899452|ref|NP_344057.1| gi|384433067|ref|YP_005642425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]