SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899454|ref|NP_344059.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899454|ref|NP_344059.1|
Domain Number 1 Region: 3-272
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 3.93e-77
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.000000872
Further Details:      
 
Domain Number 2 Region: 263-477
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.99e-65
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899454|ref|NP_344059.1|
Sequence length 502
Comment 4-hydroxybutyryl-CoA dehydratase [Sulfolobus solfataricus P2]
Sequence
MVLRTGEEYVNAIRHRNKVEIYVMGKEVKDVTEHPFLKPSVLAFKATYDAAHEEDSESLA
RAWSSFINEEVNRFTHIHRSPEDLAAKVKLLRKISHKTGACFQRCVGWDALNAIYVTSRL
MAERGKKEYYERFVEYLKYVQKNDVALAGAMTDVKGIRTLRPHEQPHAYLRVTQVTKDGI
YVSGAKANITGIGAAEEIVVMPTRAMSEKDMDFAVAFSIPLDTEGIKVIIGRQVNDGRRL
EEGEIDGLPYRTNHEGLVIFDNVFVPMERVFMLGDWQMSGILVEIFSSYHRQGYGGCKSG
LGDVIIGAAYNLAKQIGVEKAPHIQNKLNEMVLLNENMYGSGIAASLDAVKLCEDGCWWV
NPMFANVTKQLVTRFPYEITKFSTDIAGGIIGTAPSEWDLKNPKLKPYIEKYLQGMMDYS
TEDRLRMVRLLENVGFSVAFLIESVHGAGSPEAQRIAINRVYDYEYAEKIAKYLSQIEKR
IDFKENAEPWRKTDTEKIASSG
Download sequence
Identical sequences A0A0E3K7Y5 D0KPI2 Q97V96
gi|384433069|ref|YP_005642427.1| gi|15899454|ref|NP_344059.1| WP_009990277.1.14611 WP_009990277.1.22626 WP_009990277.1.43719 WP_009990277.1.57434 WP_009990277.1.66040 WP_009990277.1.8449 WP_009990277.1.93834 356183 273057.SSO2738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]