SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899477|ref|NP_344082.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899477|ref|NP_344082.1|
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 6.02e-69
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000669
Further Details:      
 
Domain Number 2 Region: 237-393
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 5.64e-45
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899477|ref|NP_344082.1|
Sequence length 398
Comment acyl-CoA dehydrogenase [Sulfolobus solfataricus P2]
Sequence
MVFPFKSLEDFKVEITQDHELLRSAVRDFAENVLAKYVERGEKELDIPLEAKQKAKEIGL
YGLFASQDLGGQGADYLSLLTATEEIARIWPSFSTFLLINWMFIYALSRFGNEELKKKYV
IPVANGDKVAAFAVTEPVAGSDVAGIKTTAKKLDGEYVINGRKIFITNGDIADYYLIAAR
TSPPDPKARWKGISMFVVEKDAVKPVSRIETTGLRSSHTAEILLEDVKVQTENLLGEEGN
GFKYAVSSFDFARTIVASQALGIGQAALEKMINYSLQRSAFEKKLAEFQLVQTKVSESLA
DLEVARLITYWAGTLFRNGKENEYTVAASLAKFISTESAERIILRAMSVYGGYGVTTSTG
LERMLRDLQIMKTYEGTNDIQRISAARFLYNKFIGYKV
Download sequence
Identical sequences A0A0E3MF90 D0KPK7 Q97V73
gi|384433094|ref|YP_005642452.1| gi|15899477|ref|NP_344082.1| WP_009990244.1.14611 WP_009990244.1.22626 WP_009990244.1.43719 WP_009990244.1.57434 WP_009990244.1.66040 WP_009990244.1.8449 WP_009990244.1.93834 273057.SSO2761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]