SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899587|ref|NP_344192.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899587|ref|NP_344192.1|
Domain Number 1 Region: 9-252
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 9.82e-82
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.000021
Further Details:      
 
Domain Number 2 Region: 239-394
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.77e-51
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899587|ref|NP_344192.1|
Sequence length 400
Comment acyl-CoA dehydrogenase [Sulfolobus solfataricus P2]
Sequence
MVLPFSSVEAFSINISEKHELFRRAVREFMERDVAPYVEKGEKEGTVPKEVLEKAKEIGL
YGVAVPEQYGGQGGDTLMTAIAQEEISRVWASLSTRISVGGLFMTPILLFGNEEQKKKYV
TPVARGDKVAAFANTEPVAGSDVAGIQTVAKKINGKYVINGRKIFITNGGIADYYVVTAR
TSPPEPNARWKGISMFIVEREWKGVKVLNRIETMGLRASNTAELAFEDVEVPAENLLGEE
GNGFKYAMATFDRTRVGVAAQGVGVAQAALERMVTYSTQRFAFQSPLIGFQMVQEKIAES
LTEVNTARLLTYWAANLFDRGLENEAIVAASMAKLYATDIAEKVAIRAITVHGGYGVATS
TGVERLLRDVEVMRIYEGANDIQKLVILRETARRLLGIKM
Download sequence
Identical sequences A0A0E3KAK6 D0KQ82 Q97UW6
gi|384433190|ref|YP_005642548.1| gi|15899587|ref|NP_344192.1| WP_009989823.1.14611 WP_009989823.1.22626 WP_009989823.1.43719 WP_009989823.1.57434 WP_009989823.1.66040 WP_009989823.1.8449 WP_009989823.1.93834 273057.SSO2877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]