SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899643|ref|NP_344248.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899643|ref|NP_344248.1|
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000134
Family Middle operon regulator, Mor 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899643|ref|NP_344248.1|
Sequence length 137
Comment partial transposase ISC1078, partial [Sulfolobus solfataricus P2]
Sequence
MPKSRMHGIRLNKKQEEERRINAVKDVRNGMSIKDVAKKYDVSIFTVYKWLRKGDLSAKP
RKGPTKLKDEEKLVRILEKSPRDFGLNYDFWTLKLIAYILDKEFGIKYNPRSLSPVLKKL
GFKYKKGKRTYVRVSGM
Download sequence
Identical sequences A0A0E3MCX3 D0KQC0 Q97UR8
gi|384433228|ref|YP_005642586.1| gi|15899643|ref|NP_344248.1| 273057.SSO2933 WP_010924042.1.8449 WP_010924042.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]