SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899699|ref|NP_344304.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899699|ref|NP_344304.1|
Domain Number 1 Region: 4-175
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-81
Family SCOPe 0.049
Further Details:      
 
Domain Number 2 Region: 184-321
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8.78e-59
Family SCOPe 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899699|ref|NP_344304.1|
Sequence length 325
Comment diphosphomevalonate decarboxylase [Sulfolobus solfataricus P2]
Sequence
MLKSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLNDKNIVIVN
DRILSEDEMKEYAGRVLDTFKKIVGKEFHVKVESKSKFPINAGLASSAAGIAALAFSLNE
LLELNLKSEELSKIARLGSGSACRSMFGGFVVWNKGEREDGEDSYCYQIFRHDYWSELVD
IIPILSEKEKKISSRKGMIRSAETSELMECRLKYIEKTFNEVIEAIRNRDEKKFYYLMMR
HSNSMHAVILDSWPSFFYLNDTSIRIMEWIHDYGKAGYTFDAGPNPHIFTTERNIGDILE
FLKSLEIKRIIVSKVGDGPKVLSRE
Download sequence
Identical sequences A0A0E3MI52 D0KQL8 Q97UL5
5gmd_A 5gme_A 273057.SSO2989 WP_009992640.1.14611 WP_009992640.1.22626 WP_009992640.1.43719 WP_009992640.1.57434 WP_009992640.1.66040 WP_009992640.1.8449 WP_009992640.1.93834 gi|15899699|ref|NP_344304.1| gi|384433280|ref|YP_005642638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]