SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899708|ref|NP_344313.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899708|ref|NP_344313.1|
Domain Number 1 Region: 94-117,170-414
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4e-67
Family D-glucarate dehydratase-like 0.0000608
Further Details:      
 
Domain Number 2 Region: 3-106
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-20
Family Enolase N-terminal domain-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899708|ref|NP_344313.1|
Sequence length 419
Comment hypothetical protein SSO2998 [Sulfolobus solfataricus P2]
Sequence
MELKITDFKVFVAQANFEWAFVRIYSKDLYGTGEAGPAPGLKGMESEFIQLLIGEDAFKV
NRIAEKLRYATLYSGTTVYHLISAINIALYDLIGKYLNVPIYKLLGGDKTEIPVYVDAHG
GKGLEAINALHLPVNLPWIKEAEVETNRLITTNNPVHGRLSMEKWNEDYSPEAYAKRALK
MKNEGYKAMKFDLDVPTPYIDLRRVRNGDLSLKDIDYMVDIVKAVRESVGDEVEIMFDLH
WRYNLNTAIRICKALEPYRLRWLEDPMPAIMAVSNYDELKLLTSQCSVPIETGENLYTVY
QFKDLLNTGVRVWAPDIVKAGGITEGRRIAELAAMYDIEYSPHNIASPIGTMAHAHVGSI
ANTFGFVEFHGHDVPFWNEIVKPKRKIIEDGVIKLTDDPGLGIDLDDEVMRKYWPTYEL
Download sequence
Identical sequences A0A0E3MCS2 D0KQM4 Q97UK8
NYSGXRC-9254a gi|384433286|ref|YP_005642644.1| WP_009992649.1.14611 WP_009992649.1.22626 WP_009992649.1.57434 WP_009992649.1.66040 WP_009992649.1.8449 WP_009992649.1.93834 gi|15899708|ref|NP_344313.1| 273057.SSO2998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]