SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899787|ref|NP_344392.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899787|ref|NP_344392.1|
Domain Number 1 Region: 6-75
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000418
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899787|ref|NP_344392.1|
Sequence length 76
Comment hypothetical protein SSO11920 [Sulfolobus solfataricus P2]
Sequence
MIPILPFYGIHDLNLISIFAILGLVFILTLIGQDSVIYTANKLPISLVTSVELIEPVIVT
LLAILIYHQIPNLQKI
Download sequence
Identical sequences C3NA72 Q97UD9
gi|229580187|ref|YP_002838587.1| 273057.SSO11920 439386.YG5714_2421 gi|15899787|ref|NP_344392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]