SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15899833|ref|NP_344438.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899833|ref|NP_344438.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily PIN domain-like 3.08e-17
Family PIN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899833|ref|NP_344438.1|
Sequence length 133
Comment hypothetical protein SSO3128 [Sulfolobus solfataricus P2]
Sequence
MRKKYVLDAGPLSLLFAGRKEIKKYFEEIYTGDAIIYMSEVNLAELLYIYILKKGKDVAI
ARHRYIRNSPIKVISPNERITENAALLKSKYSYLSLADAFLIATAKEVKGKVITTDEDIE
KTKEVETIKIPLD
Download sequence
Identical sequences A0A0E3K075 D0KQU4 Q97U93
273057.SSO3128 378194 WP_009989951.1.14611 WP_009989951.1.22626 WP_009989951.1.43719 WP_009989951.1.57434 WP_009989951.1.66040 WP_009989951.1.8449 WP_009989951.1.93834 gi|384433356|ref|YP_005642714.1| gi|15899833|ref|NP_344438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]