SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899863|ref|NP_344468.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899863|ref|NP_344468.1|
Domain Number 1 Region: 18-80
Classification Level Classification E-value
Superfamily Single hybrid motif 1.15e-16
Family Biotinyl/lipoyl-carrier proteins and domains 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899863|ref|NP_344468.1|
Sequence length 81
Comment hypothetical protein SSO12093 [Sulfolobus solfataricus P2]
Sequence
MQAELKIPEDIWPRRRDWGGEIVSLYIKEGSEIKVGDVIAEVEIEKAILKILSQYNGKVI
KVLVREGDKVSPGSVIALIEV
Download sequence
Identical sequences A0A0E3MIA0 D0KQX4 Q97U64
gi|384433386|ref|YP_005642744.1| 273057.SSO12093 gi|15899863|ref|NP_344468.1| WP_009989966.1.14611 WP_009989966.1.22626 WP_009989966.1.43719 WP_009989966.1.57434 WP_009989966.1.66040 WP_009989966.1.8449 WP_009989966.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]