SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899868|ref|NP_344473.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899868|ref|NP_344473.1|
Domain Number 1 Region: 46-217
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.94e-28
Family FAD-linked oxidases, N-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|15899868|ref|NP_344473.1|
Domain Number - Region: 352-380
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.00213
Family Vanillyl-alcohol oxidase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15899868|ref|NP_344473.1|
Sequence length 382
Comment glycolate oxidase subunit GlcE [Sulfolobus solfataricus P2]
Sequence
MYIGINIILLIKNYFYNLSPFLLMDWVDELGKIVKVSNGKDEGPARWKITAIPQTYAELR
DVIKFANEKKLSIYPFSFNMHHIGPPVSIDIGVKLSQFNNVVEISDDDLYVTSQVGVRVS
DLFEIIKAKGLFLPAYYDGSLGGLLATNLPTPFSSFYGYPKNLILMAKVITGDGIIAKGG
GKTLKFSSGYKIHKILSGMLGWLGIYLEATLKIYPFPEVIVTFQTDKVNLTSKYRPISII
YETDEKGDKTYVTFIGFRRAIEKIGEEIGAKGEDGFYSIDYTSDEKVISIHTVRGKEVDV
IRKAKSIMRVKRGIGIVGTGYCRLEVASFDNLEVLRREIDEQVVVERGYYNGDYWGIRDK
ETLQMLKEAFDPNNILQPGLIL
Download sequence
Identical sequences A0A0E3MD30 Q97U59
WP_009989973.1.14611 WP_009989973.1.22626 WP_009989973.1.43719 WP_009989973.1.57434 WP_009989973.1.66040 WP_009989973.1.8449 WP_009989973.1.93834 273057.SSO3165 gi|15899868|ref|NP_344473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]