SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899908|ref|NP_344513.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899908|ref|NP_344513.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily YjgF-like 1.23e-45
Family YjgF/L-PSP 0.00000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899908|ref|NP_344513.1|
Sequence length 126
Comment protein synthesis inhibitor [Sulfolobus solfataricus P2]
Sequence
MKEIIFTEKAPKPIGPYSQGVKVGDILYVSGQIPVDPKTNEVVGKNIEEQTIRVIENIKA
VLEAAGYMLDDVVMSFVYLKDIKDFQRFNEVYSKYFSNKPPARVTVEVSRLPRDVLIEIT
VIAQKS
Download sequence
Identical sequences A0A0E3KB05 D0KR19 Q97U19
WP_009991672.1.14611 WP_009991672.1.22626 WP_009991672.1.43719 WP_009991672.1.57434 WP_009991672.1.66040 WP_009991672.1.8449 WP_009991672.1.93834 gi|384433431|ref|YP_005642789.1| gi|15899908|ref|NP_344513.1| 273057.SSO3206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]