SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15899916|ref|NP_344521.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899916|ref|NP_344521.1|
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 2.33e-19
Family MazG-like 0.0000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15899916|ref|NP_344521.1|
Sequence length 83
Comment hypothetical protein SSO12199 [Sulfolobus solfataricus P2]
Sequence
MDLELKELQSKMKEMYFEKDSQRGIYATFTWLVEEVGELAEALLSNNLDSIQEELADVIA
WTVSIANLEGIDIEEALKKKYKL
Download sequence
Identical sequences A0A157T669 D0KR29 Q97U11
273057.SSO12199 000004127|e1vmgA1|159.1.2.1|A:13-95 d1vmga_ gi|384433441|ref|YP_005642799.1| 358109 gi|15899916|ref|NP_344521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]