SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898223|ref|NP_342828.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898223|ref|NP_342828.1|
Domain Number 1 Region: 13-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000296
Family Middle operon regulator, Mor 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898223|ref|NP_342828.1|
Sequence length 152
Comment transposon ISC1078 Orf1 [Sulfolobus solfataricus P2]
Sequence
MPKSRMHGIRLDKKQEEERRINAVKDVRNGMSIKDVAKKYDVSIFTVYKWLRKGDLSAKP
RKGPTKLKDEEKLVRILEKSPRDFGLNYDFWTLKLIAYILDKEFGIKYNPRSLSPVLKKL
GFKYKKGKRTYVRDDNAVERWVKEQGEKLLKK
Download sequence
Identical sequences A0A157T0X0 Q97YE2
WP_010923367.1.8449 273057.SSO1384 gi|15898223|ref|NP_342828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]