SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15902108|ref|NP_357658.1| from Streptococcus pneumoniae R6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15902108|ref|NP_357658.1|
Domain Number 1 Region: 17-377
Classification Level Classification E-value
Superfamily SIS domain 2.56e-54
Family double-SIS domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15902108|ref|NP_357658.1|
Sequence length 388
Comment sugar isomerase domain-containing protein [Streptococcus pneumoniae R6]
Sequence
MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAAFLQEIADKHDYIKVIL
TGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPATYLKKDVATVLVSFARSGN
SPESVATVDLAKSLVDELYQVTITCATDGKLALQAHGDDRNLLLLQPAVSNDAGFAMTSS
FTSMMLTALLVFDPTEFAVKSERFEVVSSLARKVLDKAEDVKELVDLDFNRVIYLGAGPF
FGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSLINDNTVVLVFGTTTDYTRKYDLDL
VREVAGDQIARRVVLLSDQAFGLENVKEVALGCGGVLNDIYRVFPYIVYAQLFALLTSLK
VENKPDTPSPTGTVNRVVQGVIIHEYQK
Download sequence
Identical sequences A0A0H2ZMS8 A0A0I7LPH8 Q8DRK9
171101.spr0064 373153.SPD_0070 gi|15902108|ref|NP_357658.1| NP_357658.1.60829 WP_000903562.1.100140 WP_000903562.1.100364 WP_000903562.1.100369 WP_000903562.1.101494 WP_000903562.1.10458 WP_000903562.1.10900 WP_000903562.1.10910 WP_000903562.1.11792 WP_000903562.1.12407 WP_000903562.1.13581 WP_000903562.1.13845 WP_000903562.1.15030 WP_000903562.1.15509 WP_000903562.1.15841 WP_000903562.1.16229 WP_000903562.1.17033 WP_000903562.1.19010 WP_000903562.1.19190 WP_000903562.1.20128 WP_000903562.1.2030 WP_000903562.1.20603 WP_000903562.1.20781 WP_000903562.1.21329 WP_000903562.1.21452 WP_000903562.1.2152 WP_000903562.1.23031 WP_000903562.1.23968 WP_000903562.1.2429 WP_000903562.1.24573 WP_000903562.1.25226 WP_000903562.1.25685 WP_000903562.1.26901 WP_000903562.1.27714 WP_000903562.1.28659 WP_000903562.1.28834 WP_000903562.1.30134 WP_000903562.1.30290 WP_000903562.1.30543 WP_000903562.1.3105 WP_000903562.1.32083 WP_000903562.1.32540 WP_000903562.1.3359 WP_000903562.1.33923 WP_000903562.1.34327 WP_000903562.1.3433 WP_000903562.1.351 WP_000903562.1.35727 WP_000903562.1.35827 WP_000903562.1.35920 WP_000903562.1.3638 WP_000903562.1.37357 WP_000903562.1.3780 WP_000903562.1.38887 WP_000903562.1.39533 WP_000903562.1.40106 WP_000903562.1.41267 WP_000903562.1.41317 WP_000903562.1.4143 WP_000903562.1.41932 WP_000903562.1.43051 WP_000903562.1.4328 WP_000903562.1.43558 WP_000903562.1.43741 WP_000903562.1.43972 WP_000903562.1.44699 WP_000903562.1.44825 WP_000903562.1.45112 WP_000903562.1.45118 WP_000903562.1.46184 WP_000903562.1.46665 WP_000903562.1.47651 WP_000903562.1.47806 WP_000903562.1.49216 WP_000903562.1.49407 WP_000903562.1.49511 WP_000903562.1.49656 WP_000903562.1.49692 WP_000903562.1.49874 WP_000903562.1.50582 WP_000903562.1.50911 WP_000903562.1.50915 WP_000903562.1.51079 WP_000903562.1.51367 WP_000903562.1.52245 WP_000903562.1.52268 WP_000903562.1.5261 WP_000903562.1.53291 WP_000903562.1.53773 WP_000903562.1.54001 WP_000903562.1.54656 WP_000903562.1.54938 WP_000903562.1.55256 WP_000903562.1.55385 WP_000903562.1.55685 WP_000903562.1.5586 WP_000903562.1.57194 WP_000903562.1.57279 WP_000903562.1.57366 WP_000903562.1.57750 WP_000903562.1.57753 WP_000903562.1.57892 WP_000903562.1.58020 WP_000903562.1.58225 WP_000903562.1.59018 WP_000903562.1.59867 WP_000903562.1.60188 WP_000903562.1.6046 WP_000903562.1.60977 WP_000903562.1.61302 WP_000903562.1.61632 WP_000903562.1.61735 WP_000903562.1.61882 WP_000903562.1.63788 WP_000903562.1.63927 WP_000903562.1.64224 WP_000903562.1.64269 WP_000903562.1.64572 WP_000903562.1.64931 WP_000903562.1.65091 WP_000903562.1.66470 WP_000903562.1.66500 WP_000903562.1.67443 WP_000903562.1.68460 WP_000903562.1.69037 WP_000903562.1.70046 WP_000903562.1.70904 WP_000903562.1.70987 WP_000903562.1.7123 WP_000903562.1.71955 WP_000903562.1.72115 WP_000903562.1.73185 WP_000903562.1.73227 WP_000903562.1.73500 WP_000903562.1.74387 WP_000903562.1.74548 WP_000903562.1.74796 WP_000903562.1.75074 WP_000903562.1.75191 WP_000903562.1.75787 WP_000903562.1.75976 WP_000903562.1.760 WP_000903562.1.76233 WP_000903562.1.76249 WP_000903562.1.76972 WP_000903562.1.77269 WP_000903562.1.77456 WP_000903562.1.7812 WP_000903562.1.78349 WP_000903562.1.7919 WP_000903562.1.79594 WP_000903562.1.80196 WP_000903562.1.80349 WP_000903562.1.80376 WP_000903562.1.80548 WP_000903562.1.81183 WP_000903562.1.81390 WP_000903562.1.81534 WP_000903562.1.82407 WP_000903562.1.82505 WP_000903562.1.82839 WP_000903562.1.82921 WP_000903562.1.8331 WP_000903562.1.83403 WP_000903562.1.83634 WP_000903562.1.84211 WP_000903562.1.85171 WP_000903562.1.85760 WP_000903562.1.86423 WP_000903562.1.87839 WP_000903562.1.87863 WP_000903562.1.87901 WP_000903562.1.88008 WP_000903562.1.88224 WP_000903562.1.88280 WP_000903562.1.88904 WP_000903562.1.89444 WP_000903562.1.89620 WP_000903562.1.89982 WP_000903562.1.90059 WP_000903562.1.90197 WP_000903562.1.90678 WP_000903562.1.91178 WP_000903562.1.91432 WP_000903562.1.9207 WP_000903562.1.92103 WP_000903562.1.92271 WP_000903562.1.92301 WP_000903562.1.92962 WP_000903562.1.9345 WP_000903562.1.93616 WP_000903562.1.93636 WP_000903562.1.9369 WP_000903562.1.93906 WP_000903562.1.94148 WP_000903562.1.94651 WP_000903562.1.94883 WP_000903562.1.95058 WP_000903562.1.95413 WP_000903562.1.95605 WP_000903562.1.96049 WP_000903562.1.96582 WP_000903562.1.97048 WP_000903562.1.97073 WP_000903562.1.9712 WP_000903562.1.98732 WP_000903562.1.98781 WP_000903562.1.98915 gi|116515512|ref|YP_815524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]