SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15903561|ref|NP_359111.1| from Streptococcus pneumoniae R6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15903561|ref|NP_359111.1|
Domain Number 1 Region: 91-263
Classification Level Classification E-value
Superfamily SIS domain 1.5e-32
Family mono-SIS domain 0.011
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000269
Family RpiR-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15903561|ref|NP_359111.1|
Sequence length 283
Comment phosphosugar-binding transcriptional regulator [Streptococcus pneumoniae R6]
Sequence
MDKPDIATIIDSHFEEMTDPEQEIARYFLQAETITDDLSSQQVTQKLHISQAALTRFAKK
CGFTGYREFIFQYQHQAENQANQVSKHSPLTKRVLRSYSNMREQTQDLIDEIQLERIAQL
IEDAERIYFFGTGSSGLVAREMKLRFMRLGVVCEALTDQDGFAWTTSIMDENCLVLGFSL
SGSTPSILDSLLDAKEMGAKTVLFTSVPNKNSQTYTETVLVATHSQPSYIQRISAQLPML
FFIDLIYAYFLEINRESKEKIFNSYWENKKLNGYRRQKRVRKS
Download sequence
Identical sequences Q8DNV4
NP_359111.1.60829 WP_000360342.1.2030 WP_000360342.1.90197 171101.spr1518 gi|15903561|ref|NP_359111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]