SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15903923|ref|NP_359473.1| from Streptococcus pneumoniae R6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15903923|ref|NP_359473.1|
Domain Number 1 Region: 5-448
Classification Level Classification E-value
Superfamily SIS domain 6.26e-135
Family Phosphoglucose isomerase, PGI 0.000000000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15903923|ref|NP_359473.1|
Sequence length 449
Comment glucose-6-phosphate isomerase [Streptococcus pneumoniae R6]
Sequence
MSHIKFDYSKVLDKFVAPHEVEYMQSQVTAADELIRKGTGAGSDFLGWLDLPEKYDREEF
DRILKAAEQIKSDSDVLVVIGIGGSYLGAKAAIDFLNHHFANLQTKEERKAPQILYAGNS
ISSTYLADLVEYVADKDFSVNVISKSGTTTEPAIAFRVFKELLVKKYGQEEANKRIYATT
DRQKGAVKVEADANGWGTFVVPDDIGGRFSVLTAVGLLPIAASGADIKALMEGANAARKD
YTSDKISENEAYQYAAVRNILYRKGYATEILVNYEPSLQYFSEWWKQLAGESEGKDQKGI
YPTSANFSTDLHSLGQFIQEGTRIMFETVVRVDKPRKNVLIPTLEEDLDGLGYLQGKDVD
FVNKKATDGVLLAHTDGDVPNMYVTLPEQDAFTLGYTIYFFELAIALSGYLNAINPFDQP
GVEAYKRNMFALLGKPGFEELSKELNARL
Download sequence
Identical sequences A0A0B7MGM6 B1I9D8 C1CAP9 G6JDF3 Q04IA2 Q8DN74
gi|307068684|ref|YP_003877650.1| gi|169833084|ref|YP_001695433.1| gi|225859827|ref|YP_002741337.1| gi|116516610|ref|YP_817286.1| gi|15903923|ref|NP_359473.1| gi|307128332|ref|YP_003880363.1| NP_359473.1.60829 WP_000018262.1.100011 WP_000018262.1.100033 WP_000018262.1.100039 WP_000018262.1.100048 WP_000018262.1.100109 WP_000018262.1.100110 WP_000018262.1.100158 WP_000018262.1.100168 WP_000018262.1.100186 WP_000018262.1.100263 WP_000018262.1.100325 WP_000018262.1.100333 WP_000018262.1.100339 WP_000018262.1.100341 WP_000018262.1.10049 WP_000018262.1.100516 WP_000018262.1.100529 WP_000018262.1.100540 WP_000018262.1.100547 WP_000018262.1.100634 WP_000018262.1.100640 WP_000018262.1.100734 WP_000018262.1.100756 WP_000018262.1.100839 WP_000018262.1.100855 WP_000018262.1.100863 WP_000018262.1.100892 WP_000018262.1.100911 WP_000018262.1.100914 WP_000018262.1.100937 WP_000018262.1.100940 WP_000018262.1.100997 WP_000018262.1.101044 WP_000018262.1.101061 WP_000018262.1.101062 WP_000018262.1.101098 WP_000018262.1.101106 WP_000018262.1.101116 WP_000018262.1.101167 WP_000018262.1.101181 WP_000018262.1.101201 WP_000018262.1.101205 WP_000018262.1.101213 WP_000018262.1.101215 WP_000018262.1.10122 WP_000018262.1.101232 WP_000018262.1.101250 WP_000018262.1.101287 WP_000018262.1.101373 WP_000018262.1.101407 WP_000018262.1.101435 WP_000018262.1.101455 WP_000018262.1.101464 WP_000018262.1.101494 WP_000018262.1.101500 WP_000018262.1.101537 WP_000018262.1.101649 WP_000018262.1.101685 WP_000018262.1.101689 WP_000018262.1.1017 WP_000018262.1.101709 WP_000018262.1.101738 WP_000018262.1.101746 WP_000018262.1.10175 WP_000018262.1.101784 WP_000018262.1.101801 WP_000018262.1.101842 WP_000018262.1.101857 WP_000018262.1.101895 WP_000018262.1.101912 WP_000018262.1.10192 WP_000018262.1.101988 WP_000018262.1.102086 WP_000018262.1.102129 WP_000018262.1.102141 WP_000018262.1.10221 WP_000018262.1.10284 WP_000018262.1.10295 WP_000018262.1.10316 WP_000018262.1.10364 WP_000018262.1.10367 WP_000018262.1.10426 WP_000018262.1.10458 WP_000018262.1.1050 WP_000018262.1.10500 WP_000018262.1.10571 WP_000018262.1.10574 WP_000018262.1.1059 WP_000018262.1.10599 WP_000018262.1.10622 WP_000018262.1.10683 WP_000018262.1.10692 WP_000018262.1.10708 WP_000018262.1.10713 WP_000018262.1.1076 WP_000018262.1.10760 WP_000018262.1.10789 WP_000018262.1.10819 WP_000018262.1.10820 WP_000018262.1.10827 WP_000018262.1.10910 WP_000018262.1.10932 WP_000018262.1.10933 WP_000018262.1.10934 WP_000018262.1.10937 WP_000018262.1.10948 WP_000018262.1.11007 WP_000018262.1.11035 WP_000018262.1.11079 WP_000018262.1.11085 WP_000018262.1.11131 WP_000018262.1.11139 WP_000018262.1.11151 WP_000018262.1.11154 WP_000018262.1.11197 WP_000018262.1.11233 WP_000018262.1.11243 WP_000018262.1.11260 WP_000018262.1.11279 WP_000018262.1.11298 WP_000018262.1.11328 WP_000018262.1.11337 WP_000018262.1.11358 WP_000018262.1.11383 WP_000018262.1.11409 WP_000018262.1.11435 WP_000018262.1.11439 WP_000018262.1.11486 WP_000018262.1.11509 WP_000018262.1.11510 WP_000018262.1.11517 WP_000018262.1.11546 WP_000018262.1.11563 WP_000018262.1.11573 WP_000018262.1.11617 WP_000018262.1.11652 WP_000018262.1.11664 WP_000018262.1.11682 WP_000018262.1.11706 WP_000018262.1.11760 WP_000018262.1.11765 WP_000018262.1.11792 WP_000018262.1.11811 WP_000018262.1.11823 WP_000018262.1.11849 WP_000018262.1.11922 WP_000018262.1.11950 WP_000018262.1.11967 WP_000018262.1.12024 WP_000018262.1.12044 WP_000018262.1.12046 WP_000018262.1.12062 WP_000018262.1.12085 WP_000018262.1.12099 WP_000018262.1.12113 WP_000018262.1.12128 WP_000018262.1.12131 WP_000018262.1.12134 WP_000018262.1.12140 WP_000018262.1.12154 WP_000018262.1.12182 WP_000018262.1.12198 WP_000018262.1.1221 WP_000018262.1.12222 WP_000018262.1.12243 WP_000018262.1.12273 WP_000018262.1.12306 WP_000018262.1.12312 WP_000018262.1.1233 WP_000018262.1.12336 WP_000018262.1.12339 WP_000018262.1.12383 WP_000018262.1.124 WP_000018262.1.12407 WP_000018262.1.12427 WP_000018262.1.12429 WP_000018262.1.12440 WP_000018262.1.12443 WP_000018262.1.12450 WP_000018262.1.12470 WP_000018262.1.12494 WP_000018262.1.12524 WP_000018262.1.12538 WP_000018262.1.12578 WP_000018262.1.12588 WP_000018262.1.12613 WP_000018262.1.1262 WP_000018262.1.12677 WP_000018262.1.12723 WP_000018262.1.12729 WP_000018262.1.12754 WP_000018262.1.12757 WP_000018262.1.12765 WP_000018262.1.12805 WP_000018262.1.12811 WP_000018262.1.12813 WP_000018262.1.12859 WP_000018262.1.1288 WP_000018262.1.12898 WP_000018262.1.12905 WP_000018262.1.12948 WP_000018262.1.12952 WP_000018262.1.1302 WP_000018262.1.13099 WP_000018262.1.13100 WP_000018262.1.13119 WP_000018262.1.13121 WP_000018262.1.13123 WP_000018262.1.13140 WP_000018262.1.13152 WP_000018262.1.13168 WP_000018262.1.13187 WP_000018262.1.13209 WP_000018262.1.13229 WP_000018262.1.13245 WP_000018262.1.1328 WP_000018262.1.13286 WP_000018262.1.1330 WP_000018262.1.13305 WP_000018262.1.13310 WP_000018262.1.13327 WP_000018262.1.13330 WP_000018262.1.13331 WP_000018262.1.13351 WP_000018262.1.13388 WP_000018262.1.1348 WP_000018262.1.135 WP_000018262.1.13527 WP_000018262.1.13537 WP_000018262.1.13560 WP_000018262.1.13581 WP_000018262.1.13590 WP_000018262.1.13604 WP_000018262.1.13629 WP_000018262.1.1367 WP_000018262.1.13682 WP_000018262.1.13701 WP_000018262.1.13736 WP_000018262.1.13738 WP_000018262.1.13745 WP_000018262.1.13839 WP_000018262.1.13854 WP_000018262.1.13886 WP_000018262.1.1391 WP_000018262.1.13917 WP_000018262.1.13954 WP_000018262.1.13958 WP_000018262.1.13989 WP_000018262.1.13990 WP_000018262.1.13998 WP_000018262.1.13999 WP_000018262.1.14012 WP_000018262.1.14107 WP_000018262.1.14126 WP_000018262.1.14183 WP_000018262.1.14258 WP_000018262.1.14260 WP_000018262.1.14287 WP_000018262.1.14295 WP_000018262.1.14335 WP_000018262.1.14347 WP_000018262.1.14374 WP_000018262.1.14384 WP_000018262.1.14404 WP_000018262.1.14409 WP_000018262.1.14422 WP_000018262.1.1449 WP_000018262.1.14511 WP_000018262.1.14513 WP_000018262.1.14558 WP_000018262.1.14599 WP_000018262.1.14657 WP_000018262.1.14662 WP_000018262.1.14722 WP_000018262.1.14745 WP_000018262.1.14784 WP_000018262.1.14826 WP_000018262.1.14880 WP_000018262.1.14885 WP_000018262.1.14889 WP_000018262.1.14892 WP_000018262.1.14899 WP_000018262.1.14907 WP_000018262.1.14957 WP_000018262.1.14975 WP_000018262.1.14983 WP_000018262.1.15024 WP_000018262.1.1503 WP_000018262.1.15030 WP_000018262.1.15048 WP_000018262.1.15058 WP_000018262.1.15061 WP_000018262.1.15086 WP_000018262.1.15106 WP_000018262.1.15128 WP_000018262.1.15141 WP_000018262.1.15142 WP_000018262.1.15149 WP_000018262.1.15157 WP_000018262.1.1522 WP_000018262.1.15220 WP_000018262.1.15254 WP_000018262.1.15266 WP_000018262.1.15305 WP_000018262.1.15344 WP_000018262.1.15370 WP_000018262.1.15390 WP_000018262.1.15395 WP_000018262.1.15405 WP_000018262.1.1541 WP_000018262.1.15425 WP_000018262.1.15440 WP_000018262.1.1549 WP_000018262.1.15498 WP_000018262.1.15509 WP_000018262.1.15513 WP_000018262.1.15523 WP_000018262.1.15575 WP_000018262.1.15578 WP_000018262.1.15607 WP_000018262.1.15639 WP_000018262.1.15690 WP_000018262.1.15701 WP_000018262.1.15709 WP_000018262.1.15720 WP_000018262.1.15841 WP_000018262.1.15872 WP_000018262.1.15891 WP_000018262.1.15917 WP_000018262.1.15955 WP_000018262.1.15968 WP_000018262.1.16005 WP_000018262.1.16049 WP_000018262.1.16094 WP_000018262.1.16118 WP_000018262.1.16145 WP_000018262.1.16218 WP_000018262.1.16281 WP_000018262.1.16290 WP_000018262.1.16306 WP_000018262.1.16330 WP_000018262.1.16336 WP_000018262.1.16357 WP_000018262.1.16379 WP_000018262.1.16381 WP_000018262.1.16385 WP_000018262.1.16437 WP_000018262.1.16441 WP_000018262.1.16457 WP_000018262.1.16509 WP_000018262.1.16514 WP_000018262.1.16521 WP_000018262.1.16555 WP_000018262.1.16575 WP_000018262.1.16662 WP_000018262.1.16676 WP_000018262.1.16727 WP_000018262.1.168 WP_000018262.1.16813 WP_000018262.1.1682 WP_000018262.1.16831 WP_000018262.1.16832 WP_000018262.1.1686 WP_000018262.1.16884 WP_000018262.1.16889 WP_000018262.1.16902 WP_000018262.1.16974 WP_000018262.1.1698 WP_000018262.1.16981 WP_000018262.1.17003 WP_000018262.1.17033 WP_000018262.1.17045 WP_000018262.1.17091 WP_000018262.1.17133 WP_000018262.1.17144 WP_000018262.1.17163 WP_000018262.1.17208 WP_000018262.1.17257 WP_000018262.1.17286 WP_000018262.1.17312 WP_000018262.1.17315 WP_000018262.1.17340 WP_000018262.1.17363 WP_000018262.1.1742 WP_000018262.1.17426 WP_000018262.1.17470 WP_000018262.1.17562 WP_000018262.1.17601 WP_000018262.1.17602 WP_000018262.1.17609 WP_000018262.1.17691 WP_000018262.1.17706 WP_000018262.1.17715 WP_000018262.1.17775 WP_000018262.1.17776 WP_000018262.1.17820 WP_000018262.1.17822 WP_000018262.1.17826 WP_000018262.1.17839 WP_000018262.1.17854 WP_000018262.1.17895 WP_000018262.1.17942 WP_000018262.1.17965 WP_000018262.1.180 WP_000018262.1.18012 WP_000018262.1.18018 WP_000018262.1.18040 WP_000018262.1.18067 WP_000018262.1.18130 WP_000018262.1.18147 WP_000018262.1.18166 WP_000018262.1.18180 WP_000018262.1.18258 WP_000018262.1.1826 WP_000018262.1.18266 WP_000018262.1.18276 WP_000018262.1.18285 WP_000018262.1.18300 WP_000018262.1.18342 WP_000018262.1.18357 WP_000018262.1.184 WP_000018262.1.18404 WP_000018262.1.18415 WP_000018262.1.18417 WP_000018262.1.18449 WP_000018262.1.18481 WP_000018262.1.18488 WP_000018262.1.18496 WP_000018262.1.18514 WP_000018262.1.18521 WP_000018262.1.18555 WP_000018262.1.1856 WP_000018262.1.18619 WP_000018262.1.18634 WP_000018262.1.18652 WP_000018262.1.18687 WP_000018262.1.1872 WP_000018262.1.18733 WP_000018262.1.18771 WP_000018262.1.18773 WP_000018262.1.18864 WP_000018262.1.1894 WP_000018262.1.18951 WP_000018262.1.1902 WP_000018262.1.19049 WP_000018262.1.19124 WP_000018262.1.19157 WP_000018262.1.19162 WP_000018262.1.19166 WP_000018262.1.19190 WP_000018262.1.19201 WP_000018262.1.19218 WP_000018262.1.19236 WP_000018262.1.19275 WP_000018262.1.19383 WP_000018262.1.19385 WP_000018262.1.19413 WP_000018262.1.19467 WP_000018262.1.19489 WP_000018262.1.19490 WP_000018262.1.19493 WP_000018262.1.19510 WP_000018262.1.19513 WP_000018262.1.19532 WP_000018262.1.19558 WP_000018262.1.19633 WP_000018262.1.19677 WP_000018262.1.19729 WP_000018262.1.19730 WP_000018262.1.19811 WP_000018262.1.19827 WP_000018262.1.19832 WP_000018262.1.1985 WP_000018262.1.19856 WP_000018262.1.19879 WP_000018262.1.19925 WP_000018262.1.19983 WP_000018262.1.20015 WP_000018262.1.20079 WP_000018262.1.20110 WP_000018262.1.20128 WP_000018262.1.20149 WP_000018262.1.20185 WP_000018262.1.20213 WP_000018262.1.20227 WP_000018262.1.20241 WP_000018262.1.20250 WP_000018262.1.20274 WP_000018262.1.20279 WP_000018262.1.20281 WP_000018262.1.2030 WP_000018262.1.20301 WP_000018262.1.20312 WP_000018262.1.20328 WP_000018262.1.20382 WP_000018262.1.20385 WP_000018262.1.20396 WP_000018262.1.20408 WP_000018262.1.20422 WP_000018262.1.20451 WP_000018262.1.2048 WP_000018262.1.20486 WP_000018262.1.20509 WP_000018262.1.2060 WP_000018262.1.20603 WP_000018262.1.20634 WP_000018262.1.20637 WP_000018262.1.20657 WP_000018262.1.20671 WP_000018262.1.20702 WP_000018262.1.20711 WP_000018262.1.20837 WP_000018262.1.20856 WP_000018262.1.20858 WP_000018262.1.20942 WP_000018262.1.20952 WP_000018262.1.20965 WP_000018262.1.20981 WP_000018262.1.20984 WP_000018262.1.20988 WP_000018262.1.20996 WP_000018262.1.21090 WP_000018262.1.21176 WP_000018262.1.21211 WP_000018262.1.21214 WP_000018262.1.21233 WP_000018262.1.21244 WP_000018262.1.21256 WP_000018262.1.21278 WP_000018262.1.21297 WP_000018262.1.21329 WP_000018262.1.21331 WP_000018262.1.21355 WP_000018262.1.21377 WP_000018262.1.21421 WP_000018262.1.21433 WP_000018262.1.21445 WP_000018262.1.21452 WP_000018262.1.2148 WP_000018262.1.21503 WP_000018262.1.21599 WP_000018262.1.21605 WP_000018262.1.21612 WP_000018262.1.21682 WP_000018262.1.21735 WP_000018262.1.21753 WP_000018262.1.21781 WP_000018262.1.2180 WP_000018262.1.21807 WP_000018262.1.21816 WP_000018262.1.21822 WP_000018262.1.21838 WP_000018262.1.21885 WP_000018262.1.21904 WP_000018262.1.21957 WP_000018262.1.21997 WP_000018262.1.2203 WP_000018262.1.22048 WP_000018262.1.22057 WP_000018262.1.22083 WP_000018262.1.22119 WP_000018262.1.22121 WP_000018262.1.22122 WP_000018262.1.22124 WP_000018262.1.22131 WP_000018262.1.22135 WP_000018262.1.22186 WP_000018262.1.22201 WP_000018262.1.223 WP_000018262.1.22341 WP_000018262.1.22382 WP_000018262.1.22436 WP_000018262.1.22457 WP_000018262.1.22497 WP_000018262.1.22546 WP_000018262.1.2255 WP_000018262.1.22554 WP_000018262.1.22563 WP_000018262.1.2257 WP_000018262.1.2260 WP_000018262.1.22612 WP_000018262.1.22638 WP_000018262.1.22677 WP_000018262.1.22700 WP_000018262.1.22711 WP_000018262.1.22745 WP_000018262.1.22753 WP_000018262.1.22761 WP_000018262.1.22784 WP_000018262.1.22791 WP_000018262.1.22884 WP_000018262.1.2291 WP_000018262.1.22938 WP_000018262.1.22941 WP_000018262.1.2295 WP_000018262.1.22955 WP_000018262.1.2296 WP_000018262.1.22976 WP_000018262.1.23028 WP_000018262.1.23039 WP_000018262.1.23083 WP_000018262.1.23097 WP_000018262.1.2311 WP_000018262.1.23138 WP_000018262.1.23177 WP_000018262.1.23276 WP_000018262.1.23354 WP_000018262.1.23397 WP_000018262.1.23415 WP_000018262.1.23536 WP_000018262.1.2361 WP_000018262.1.23620 WP_000018262.1.23635 WP_000018262.1.23668 WP_000018262.1.23703 WP_000018262.1.23722 WP_000018262.1.23742 WP_000018262.1.23847 WP_000018262.1.23853 WP_000018262.1.23930 WP_000018262.1.23968 WP_000018262.1.23978 WP_000018262.1.23991 WP_000018262.1.24010 WP_000018262.1.24043 WP_000018262.1.24060 WP_000018262.1.24098 WP_000018262.1.24116 WP_000018262.1.24146 WP_000018262.1.24203 WP_000018262.1.24218 WP_000018262.1.24220 WP_000018262.1.24222 WP_000018262.1.243 WP_000018262.1.24312 WP_000018262.1.24401 WP_000018262.1.2444 WP_000018262.1.24440 WP_000018262.1.24481 WP_000018262.1.24497 WP_000018262.1.24501 WP_000018262.1.24522 WP_000018262.1.24540 WP_000018262.1.24562 WP_000018262.1.24573 WP_000018262.1.24610 WP_000018262.1.24620 WP_000018262.1.24630 WP_000018262.1.24653 WP_000018262.1.24678 WP_000018262.1.24724 WP_000018262.1.24742 WP_000018262.1.24788 WP_000018262.1.24812 WP_000018262.1.24825 WP_000018262.1.24874 WP_000018262.1.24910 WP_000018262.1.24947 WP_000018262.1.24993 WP_000018262.1.25106 WP_000018262.1.25124 WP_000018262.1.25139 WP_000018262.1.25153 WP_000018262.1.25186 WP_000018262.1.25202 WP_000018262.1.25222 WP_000018262.1.25226 WP_000018262.1.25228 WP_000018262.1.25242 WP_000018262.1.25264 WP_000018262.1.25293 WP_000018262.1.25298 WP_000018262.1.2533 WP_000018262.1.25337 WP_000018262.1.25340 WP_000018262.1.25366 WP_000018262.1.25384 WP_000018262.1.25439 WP_000018262.1.25483 WP_000018262.1.25494 WP_000018262.1.2553 WP_000018262.1.25660 WP_000018262.1.25714 WP_000018262.1.25754 WP_000018262.1.25767 WP_000018262.1.25768 WP_000018262.1.25771 WP_000018262.1.25785 WP_000018262.1.25791 WP_000018262.1.25845 WP_000018262.1.2586 WP_000018262.1.25875 WP_000018262.1.25883 WP_000018262.1.25888 WP_000018262.1.25986 WP_000018262.1.25994 WP_000018262.1.26041 WP_000018262.1.2610 WP_000018262.1.26165 WP_000018262.1.26208 WP_000018262.1.26220 WP_000018262.1.26369 WP_000018262.1.26413 WP_000018262.1.26432 WP_000018262.1.26470 WP_000018262.1.26496 WP_000018262.1.26497 WP_000018262.1.26518 WP_000018262.1.26544 WP_000018262.1.26566 WP_000018262.1.26725 WP_000018262.1.26743 WP_000018262.1.26755 WP_000018262.1.26785 WP_000018262.1.26799 WP_000018262.1.26818 WP_000018262.1.26823 WP_000018262.1.26855 WP_000018262.1.26858 WP_000018262.1.26877 WP_000018262.1.26901 WP_000018262.1.26909 WP_000018262.1.26910 WP_000018262.1.26926 WP_000018262.1.26953 WP_000018262.1.26968 WP_000018262.1.26990 WP_000018262.1.26994 WP_000018262.1.27007 WP_000018262.1.27047 WP_000018262.1.27048 WP_000018262.1.27078 WP_000018262.1.27082 WP_000018262.1.27119 WP_000018262.1.27135 WP_000018262.1.27149 WP_000018262.1.2721 WP_000018262.1.27267 WP_000018262.1.27289 WP_000018262.1.27308 WP_000018262.1.27347 WP_000018262.1.27362 WP_000018262.1.27394 WP_000018262.1.27418 WP_000018262.1.27440 WP_000018262.1.27479 WP_000018262.1.2752 WP_000018262.1.27581 WP_000018262.1.276 WP_000018262.1.27601 WP_000018262.1.27610 WP_000018262.1.27661 WP_000018262.1.27686 WP_000018262.1.27690 WP_000018262.1.27740 WP_000018262.1.27759 WP_000018262.1.27768 WP_000018262.1.27829 WP_000018262.1.27862 WP_000018262.1.27866 WP_000018262.1.27887 WP_000018262.1.2791 WP_000018262.1.27912 WP_000018262.1.27970 WP_000018262.1.28058 WP_000018262.1.28068 WP_000018262.1.28121 WP_000018262.1.28140 WP_000018262.1.28146 WP_000018262.1.28162 WP_000018262.1.28180 WP_000018262.1.28183 WP_000018262.1.28231 WP_000018262.1.28248 WP_000018262.1.28264 WP_000018262.1.2830 WP_000018262.1.28351 WP_000018262.1.28353 WP_000018262.1.28450 WP_000018262.1.28451 WP_000018262.1.28458 WP_000018262.1.28537 WP_000018262.1.28549 WP_000018262.1.28589 WP_000018262.1.28604 WP_000018262.1.28608 WP_000018262.1.2861 WP_000018262.1.28659 WP_000018262.1.28667 WP_000018262.1.2868 WP_000018262.1.28680 WP_000018262.1.28708 WP_000018262.1.28714 WP_000018262.1.28740 WP_000018262.1.28746 WP_000018262.1.28761 WP_000018262.1.28771 WP_000018262.1.28794 WP_000018262.1.28812 WP_000018262.1.28816 WP_000018262.1.28834 WP_000018262.1.28836 WP_000018262.1.28841 WP_000018262.1.28956 WP_000018262.1.29009 WP_000018262.1.29018 WP_000018262.1.29041 WP_000018262.1.29069 WP_000018262.1.2909 WP_000018262.1.29098 WP_000018262.1.2911 WP_000018262.1.29151 WP_000018262.1.29181 WP_000018262.1.2922 WP_000018262.1.29222 WP_000018262.1.29300 WP_000018262.1.29321 WP_000018262.1.29337 WP_000018262.1.29351 WP_000018262.1.29357 WP_000018262.1.29360 WP_000018262.1.29406 WP_000018262.1.29469 WP_000018262.1.29549 WP_000018262.1.29624 WP_000018262.1.29626 WP_000018262.1.29628 WP_000018262.1.29655 WP_000018262.1.29694 WP_000018262.1.29730 WP_000018262.1.29751 WP_000018262.1.29783 WP_000018262.1.29810 WP_000018262.1.29828 WP_000018262.1.29921 WP_000018262.1.29929 WP_000018262.1.29951 WP_000018262.1.3011 WP_000018262.1.30133 WP_000018262.1.30134 WP_000018262.1.30135 WP_000018262.1.30151 WP_000018262.1.30167 WP_000018262.1.30233 WP_000018262.1.30234 WP_000018262.1.30250 WP_000018262.1.30290 WP_000018262.1.30295 WP_000018262.1.30297 WP_000018262.1.30301 WP_000018262.1.30305 WP_000018262.1.30326 WP_000018262.1.30370 WP_000018262.1.30405 WP_000018262.1.30443 WP_000018262.1.30446 WP_000018262.1.30515 WP_000018262.1.30543 WP_000018262.1.30564 WP_000018262.1.30588 WP_000018262.1.30591 WP_000018262.1.3061 WP_000018262.1.30647 WP_000018262.1.30672 WP_000018262.1.30676 WP_000018262.1.30705 WP_000018262.1.30711 WP_000018262.1.30795 WP_000018262.1.3085 WP_000018262.1.30864 WP_000018262.1.30869 WP_000018262.1.30917 WP_000018262.1.30923 WP_000018262.1.30933 WP_000018262.1.30942 WP_000018262.1.30956 WP_000018262.1.3096 WP_000018262.1.30964 WP_000018262.1.30984 WP_000018262.1.31031 WP_000018262.1.3105 WP_000018262.1.31057 WP_000018262.1.31082 WP_000018262.1.31099 WP_000018262.1.31191 WP_000018262.1.31218 WP_000018262.1.31275 WP_000018262.1.31276 WP_000018262.1.3133 WP_000018262.1.31383 WP_000018262.1.31420 WP_000018262.1.31443 WP_000018262.1.31488 WP_000018262.1.31545 WP_000018262.1.31550 WP_000018262.1.3156 WP_000018262.1.31574 WP_000018262.1.31603 WP_000018262.1.31652 WP_000018262.1.31759 WP_000018262.1.31767 WP_000018262.1.31780 WP_000018262.1.31822 WP_000018262.1.31889 WP_000018262.1.31912 WP_000018262.1.31915 WP_000018262.1.31935 WP_000018262.1.31945 WP_000018262.1.31974 WP_000018262.1.31996 WP_000018262.1.320 WP_000018262.1.32027 WP_000018262.1.32079 WP_000018262.1.32080 WP_000018262.1.32084 WP_000018262.1.32108 WP_000018262.1.32117 WP_000018262.1.32139 WP_000018262.1.32187 WP_000018262.1.32288 WP_000018262.1.32290 WP_000018262.1.32296 WP_000018262.1.32303 WP_000018262.1.32313 WP_000018262.1.32362 WP_000018262.1.3241 WP_000018262.1.32419 WP_000018262.1.32444 WP_000018262.1.32469 WP_000018262.1.3255 WP_000018262.1.32604 WP_000018262.1.32644 WP_000018262.1.32667 WP_000018262.1.32734 WP_000018262.1.32794 WP_000018262.1.32816 WP_000018262.1.32876 WP_000018262.1.32923 WP_000018262.1.32994 WP_000018262.1.33001 WP_000018262.1.33013 WP_000018262.1.33072 WP_000018262.1.33073 WP_000018262.1.33100 WP_000018262.1.33128 WP_000018262.1.33180 WP_000018262.1.33182 WP_000018262.1.3319 WP_000018262.1.33233 WP_000018262.1.33259 WP_000018262.1.33291 WP_000018262.1.33334 WP_000018262.1.33354 WP_000018262.1.33359 WP_000018262.1.33378 WP_000018262.1.33391 WP_000018262.1.33415 WP_000018262.1.33430 WP_000018262.1.33436 WP_000018262.1.33437 WP_000018262.1.33451 WP_000018262.1.33454 WP_000018262.1.33511 WP_000018262.1.33528 WP_000018262.1.33589 WP_000018262.1.33598 WP_000018262.1.33666 WP_000018262.1.33709 WP_000018262.1.33710 WP_000018262.1.33719 WP_000018262.1.33749 WP_000018262.1.33758 WP_000018262.1.33788 WP_000018262.1.33815 WP_000018262.1.3384 WP_000018262.1.33859 WP_000018262.1.33878 WP_000018262.1.33881 WP_000018262.1.33891 WP_000018262.1.33923 WP_000018262.1.33933 WP_000018262.1.33953 WP_000018262.1.34054 WP_000018262.1.34097 WP_000018262.1.34162 WP_000018262.1.34176 WP_000018262.1.34262 WP_000018262.1.3427 WP_000018262.1.34291 WP_000018262.1.34297 WP_000018262.1.3433 WP_000018262.1.34375 WP_000018262.1.34503 WP_000018262.1.34586 WP_000018262.1.34598 WP_000018262.1.34601 WP_000018262.1.3464 WP_000018262.1.34719 WP_000018262.1.34742 WP_000018262.1.34744 WP_000018262.1.34754 WP_000018262.1.34772 WP_000018262.1.34776 WP_000018262.1.34848 WP_000018262.1.3486 WP_000018262.1.34872 WP_000018262.1.3488 WP_000018262.1.34899 WP_000018262.1.34973 WP_000018262.1.3502 WP_000018262.1.35034 WP_000018262.1.35042 WP_000018262.1.35064 WP_000018262.1.35076 WP_000018262.1.351 WP_000018262.1.35117 WP_000018262.1.35151 WP_000018262.1.35152 WP_000018262.1.35157 WP_000018262.1.35167 WP_000018262.1.35218 WP_000018262.1.35239 WP_000018262.1.35247 WP_000018262.1.35248 WP_000018262.1.35447 WP_000018262.1.35459 WP_000018262.1.35523 WP_000018262.1.35528 WP_000018262.1.356 WP_000018262.1.35655 WP_000018262.1.35665 WP_000018262.1.35685 WP_000018262.1.35702 WP_000018262.1.35721 WP_000018262.1.35727 WP_000018262.1.35735 WP_000018262.1.3585 WP_000018262.1.35875 WP_000018262.1.35882 WP_000018262.1.3589 WP_000018262.1.3596 WP_000018262.1.35960 WP_000018262.1.3597 WP_000018262.1.36 WP_000018262.1.36002 WP_000018262.1.36054 WP_000018262.1.3608 WP_000018262.1.3609 WP_000018262.1.36090 WP_000018262.1.36139 WP_000018262.1.36144 WP_000018262.1.3616 WP_000018262.1.36162 WP_000018262.1.3619 WP_000018262.1.3625 WP_000018262.1.36272 WP_000018262.1.36300 WP_000018262.1.36330 WP_000018262.1.36377 WP_000018262.1.3638 WP_000018262.1.36404 WP_000018262.1.36411 WP_000018262.1.36429 WP_000018262.1.36463 WP_000018262.1.36471 WP_000018262.1.36476 WP_000018262.1.36486 WP_000018262.1.36493 WP_000018262.1.36538 WP_000018262.1.36546 WP_000018262.1.36568 WP_000018262.1.36591 WP_000018262.1.36641 WP_000018262.1.36651 WP_000018262.1.36653 WP_000018262.1.36688 WP_000018262.1.36715 WP_000018262.1.36731 WP_000018262.1.36757 WP_000018262.1.36762 WP_000018262.1.36772 WP_000018262.1.36780 WP_000018262.1.36789 WP_000018262.1.36803 WP_000018262.1.36867 WP_000018262.1.36923 WP_000018262.1.36943 WP_000018262.1.36961 WP_000018262.1.36982 WP_000018262.1.36992 WP_000018262.1.36994 WP_000018262.1.36999 WP_000018262.1.37022 WP_000018262.1.37033 WP_000018262.1.37034 WP_000018262.1.3705 WP_000018262.1.37118 WP_000018262.1.37142 WP_000018262.1.37164 WP_000018262.1.37170 WP_000018262.1.37194 WP_000018262.1.37227 WP_000018262.1.37230 WP_000018262.1.37243 WP_000018262.1.37246 WP_000018262.1.37268 WP_000018262.1.3727 WP_000018262.1.37282 WP_000018262.1.37300 WP_000018262.1.37310 WP_000018262.1.37346 WP_000018262.1.37390 WP_000018262.1.37415 WP_000018262.1.37457 WP_000018262.1.37479 WP_000018262.1.37488 WP_000018262.1.37575 WP_000018262.1.37599 WP_000018262.1.37629 WP_000018262.1.37658 WP_000018262.1.37684 WP_000018262.1.37707 WP_000018262.1.37728 WP_000018262.1.37746 WP_000018262.1.37790 WP_000018262.1.3780 WP_000018262.1.37827 WP_000018262.1.37883 WP_000018262.1.37921 WP_000018262.1.37989 WP_000018262.1.38024 WP_000018262.1.38029 WP_000018262.1.38056 WP_000018262.1.38093 WP_000018262.1.38161 WP_000018262.1.38170 WP_000018262.1.38184 WP_000018262.1.38288 WP_000018262.1.38355 WP_000018262.1.38374 WP_000018262.1.3844 WP_000018262.1.38465 WP_000018262.1.38506 WP_000018262.1.38519 WP_000018262.1.38527 WP_000018262.1.38588 WP_000018262.1.38602 WP_000018262.1.38624 WP_000018262.1.3864 WP_000018262.1.38643 WP_000018262.1.38665 WP_000018262.1.38695 WP_000018262.1.38697 WP_000018262.1.38708 WP_000018262.1.38712 WP_000018262.1.38738 WP_000018262.1.38742 WP_000018262.1.3882 WP_000018262.1.38825 WP_000018262.1.3883 WP_000018262.1.38840 WP_000018262.1.38860 WP_000018262.1.38906 WP_000018262.1.38918 WP_000018262.1.38934 WP_000018262.1.38949 WP_000018262.1.38969 WP_000018262.1.3899 WP_000018262.1.39033 WP_000018262.1.39051 WP_000018262.1.39071 WP_000018262.1.39079 WP_000018262.1.39083 WP_000018262.1.39087 WP_000018262.1.39091 WP_000018262.1.39097 WP_000018262.1.39104 WP_000018262.1.39124 WP_000018262.1.39125 WP_000018262.1.39175 WP_000018262.1.39189 WP_000018262.1.3928 WP_000018262.1.39292 WP_000018262.1.39304 WP_000018262.1.39322 WP_000018262.1.39336 WP_000018262.1.39339 WP_000018262.1.39343 WP_000018262.1.39357 WP_000018262.1.3939 WP_000018262.1.39431 WP_000018262.1.39479 WP_000018262.1.3948 WP_000018262.1.39533 WP_000018262.1.39569 WP_000018262.1.39585 WP_000018262.1.39591 WP_000018262.1.3966 WP_000018262.1.39663 WP_000018262.1.39719 WP_000018262.1.39731 WP_000018262.1.39736 WP_000018262.1.39754 WP_000018262.1.39793 WP_000018262.1.39813 WP_000018262.1.39824 WP_000018262.1.39828 WP_000018262.1.39833 WP_000018262.1.39866 WP_000018262.1.39948 WP_000018262.1.39985 WP_000018262.1.39990 WP_000018262.1.40007 WP_000018262.1.40027 WP_000018262.1.40041 WP_000018262.1.40050 WP_000018262.1.4008 WP_000018262.1.40106 WP_000018262.1.40122 WP_000018262.1.40176 WP_000018262.1.40182 WP_000018262.1.4023 WP_000018262.1.40251 WP_000018262.1.40269 WP_000018262.1.40274 WP_000018262.1.40290 WP_000018262.1.40296 WP_000018262.1.40303 WP_000018262.1.40325 WP_000018262.1.40327 WP_000018262.1.40333 WP_000018262.1.40347 WP_000018262.1.40376 WP_000018262.1.40422 WP_000018262.1.40434 WP_000018262.1.40457 WP_000018262.1.40479 WP_000018262.1.40515 WP_000018262.1.40574 WP_000018262.1.40602 WP_000018262.1.40667 WP_000018262.1.40726 WP_000018262.1.40728 WP_000018262.1.40736 WP_000018262.1.40738 WP_000018262.1.40739 WP_000018262.1.40746 WP_000018262.1.40754 WP_000018262.1.4084 WP_000018262.1.40879 WP_000018262.1.40887 WP_000018262.1.4094 WP_000018262.1.40960 WP_000018262.1.40968 WP_000018262.1.40971 WP_000018262.1.40974 WP_000018262.1.40985 WP_000018262.1.41012 WP_000018262.1.41021 WP_000018262.1.41068 WP_000018262.1.41071 WP_000018262.1.41126 WP_000018262.1.41138 WP_000018262.1.41162 WP_000018262.1.41186 WP_000018262.1.41209 WP_000018262.1.41267 WP_000018262.1.41268 WP_000018262.1.41275 WP_000018262.1.4128 WP_000018262.1.41306 WP_000018262.1.41317 WP_000018262.1.41319 WP_000018262.1.41360 WP_000018262.1.4143 WP_000018262.1.41450 WP_000018262.1.4147 WP_000018262.1.415 WP_000018262.1.41508 WP_000018262.1.4152 WP_000018262.1.41527 WP_000018262.1.41551 WP_000018262.1.4159 WP_000018262.1.41607 WP_000018262.1.41684 WP_000018262.1.41697 WP_000018262.1.417 WP_000018262.1.41709 WP_000018262.1.41739 WP_000018262.1.41763 WP_000018262.1.41827 WP_000018262.1.41914 WP_000018262.1.41932 WP_000018262.1.41961 WP_000018262.1.42021 WP_000018262.1.42024 WP_000018262.1.42086 WP_000018262.1.42100 WP_000018262.1.42106 WP_000018262.1.42140 WP_000018262.1.42199 WP_000018262.1.42229 WP_000018262.1.42232 WP_000018262.1.42266 WP_000018262.1.42275 WP_000018262.1.42315 WP_000018262.1.42331 WP_000018262.1.42337 WP_000018262.1.42437 WP_000018262.1.42450 WP_000018262.1.4249 WP_000018262.1.42515 WP_000018262.1.42536 WP_000018262.1.42546 WP_000018262.1.42566 WP_000018262.1.42611 WP_000018262.1.42625 WP_000018262.1.427 WP_000018262.1.42715 WP_000018262.1.42741 WP_000018262.1.42743 WP_000018262.1.42807 WP_000018262.1.42817 WP_000018262.1.42820 WP_000018262.1.4283 WP_000018262.1.42846 WP_000018262.1.42906 WP_000018262.1.42911 WP_000018262.1.42935 WP_000018262.1.42938 WP_000018262.1.42964 WP_000018262.1.43015 WP_000018262.1.43059 WP_000018262.1.43066 WP_000018262.1.43074 WP_000018262.1.43101 WP_000018262.1.43192 WP_000018262.1.4320 WP_000018262.1.43205 WP_000018262.1.43207 WP_000018262.1.43229 WP_000018262.1.4328 WP_000018262.1.43345 WP_000018262.1.43347 WP_000018262.1.43361 WP_000018262.1.43367 WP_000018262.1.43390 WP_000018262.1.434 WP_000018262.1.43408 WP_000018262.1.43423 WP_000018262.1.43424 WP_000018262.1.43440 WP_000018262.1.43467 WP_000018262.1.43496 WP_000018262.1.43518 WP_000018262.1.43539 WP_000018262.1.43634 WP_000018262.1.43644 WP_000018262.1.43701 WP_000018262.1.43714 WP_000018262.1.43723 WP_000018262.1.43739 WP_000018262.1.43741 WP_000018262.1.43744 WP_000018262.1.43774 WP_000018262.1.43775 WP_000018262.1.43792 WP_000018262.1.43845 WP_000018262.1.43848 WP_000018262.1.43870 WP_000018262.1.43889 WP_000018262.1.43910 WP_000018262.1.43972 WP_000018262.1.43979 WP_000018262.1.44003 WP_000018262.1.44022 WP_000018262.1.44024 WP_000018262.1.44042 WP_000018262.1.44073 WP_000018262.1.4409 WP_000018262.1.44127 WP_000018262.1.44131 WP_000018262.1.44135 WP_000018262.1.44138 WP_000018262.1.44145 WP_000018262.1.44156 WP_000018262.1.4420 WP_000018262.1.44209 WP_000018262.1.44218 WP_000018262.1.4425 WP_000018262.1.44306 WP_000018262.1.44335 WP_000018262.1.44379 WP_000018262.1.44473 WP_000018262.1.44487 WP_000018262.1.44496 WP_000018262.1.44550 WP_000018262.1.4456 WP_000018262.1.44574 WP_000018262.1.44595 WP_000018262.1.44616 WP_000018262.1.44682 WP_000018262.1.44699 WP_000018262.1.44711 WP_000018262.1.44825 WP_000018262.1.44835 WP_000018262.1.44844 WP_000018262.1.44858 WP_000018262.1.44894 WP_000018262.1.4491 WP_000018262.1.44921 WP_000018262.1.44938 WP_000018262.1.44972 WP_000018262.1.45051 WP_000018262.1.45065 WP_000018262.1.45087 WP_000018262.1.45109 WP_000018262.1.45112 WP_000018262.1.45118 WP_000018262.1.45166 WP_000018262.1.45196 WP_000018262.1.45224 WP_000018262.1.4525 WP_000018262.1.45261 WP_000018262.1.45263 WP_000018262.1.45266 WP_000018262.1.45276 WP_000018262.1.45287 WP_000018262.1.45300 WP_000018262.1.45325 WP_000018262.1.45346 WP_000018262.1.4536 WP_000018262.1.45370 WP_000018262.1.45378 WP_000018262.1.45417 WP_000018262.1.45433 WP_000018262.1.4547 WP_000018262.1.45481 WP_000018262.1.45505 WP_000018262.1.45506 WP_000018262.1.45539 WP_000018262.1.4554 WP_000018262.1.4556 WP_000018262.1.45572 WP_000018262.1.4559 WP_000018262.1.45601 WP_000018262.1.45639 WP_000018262.1.45652 WP_000018262.1.45673 WP_000018262.1.45687 WP_000018262.1.45753 WP_000018262.1.45762 WP_000018262.1.45810 WP_000018262.1.45820 WP_000018262.1.45879 WP_000018262.1.45886 WP_000018262.1.45909 WP_000018262.1.45948 WP_000018262.1.45952 WP_000018262.1.45981 WP_000018262.1.45993 WP_000018262.1.46024 WP_000018262.1.46074 WP_000018262.1.46088 WP_000018262.1.46156 WP_000018262.1.46158 WP_000018262.1.46178 WP_000018262.1.46290 WP_000018262.1.46296 WP_000018262.1.46470 WP_000018262.1.46480 WP_000018262.1.46495 WP_000018262.1.46500 WP_000018262.1.46564 WP_000018262.1.46565 WP_000018262.1.46607 WP_000018262.1.46610 WP_000018262.1.46634 WP_000018262.1.46649 WP_000018262.1.4667 WP_000018262.1.46683 WP_000018262.1.46695 WP_000018262.1.46716 WP_000018262.1.46784 WP_000018262.1.46822 WP_000018262.1.46878 WP_000018262.1.46893 WP_000018262.1.46901 WP_000018262.1.46915 WP_000018262.1.46919 WP_000018262.1.46923 WP_000018262.1.46955 WP_000018262.1.46966 WP_000018262.1.47004 WP_000018262.1.47045 WP_000018262.1.47076 WP_000018262.1.47099 WP_000018262.1.47103 WP_000018262.1.47133 WP_000018262.1.47168 WP_000018262.1.47180 WP_000018262.1.47213 WP_000018262.1.47272 WP_000018262.1.47288 WP_000018262.1.47327 WP_000018262.1.47338 WP_000018262.1.47351 WP_000018262.1.47365 WP_000018262.1.47420 WP_000018262.1.47462 WP_000018262.1.47483 WP_000018262.1.47490 WP_000018262.1.47513 WP_000018262.1.47526 WP_000018262.1.47569 WP_000018262.1.47635 WP_000018262.1.4768 WP_000018262.1.47712 WP_000018262.1.47781 WP_000018262.1.478 WP_000018262.1.47806 WP_000018262.1.47819 WP_000018262.1.47853 WP_000018262.1.47890 WP_000018262.1.4790 WP_000018262.1.47923 WP_000018262.1.47977 WP_000018262.1.4798 WP_000018262.1.47987 WP_000018262.1.48015 WP_000018262.1.4804 WP_000018262.1.48137 WP_000018262.1.48213 WP_000018262.1.4822 WP_000018262.1.48257 WP_000018262.1.48339 WP_000018262.1.48349 WP_000018262.1.48381 WP_000018262.1.48384 WP_000018262.1.48387 WP_000018262.1.48422 WP_000018262.1.48481 WP_000018262.1.48504 WP_000018262.1.48520 WP_000018262.1.48533 WP_000018262.1.48582 WP_000018262.1.48595 WP_000018262.1.48604 WP_000018262.1.48613 WP_000018262.1.48614 WP_000018262.1.48619 WP_000018262.1.48731 WP_000018262.1.48739 WP_000018262.1.48753 WP_000018262.1.48758 WP_000018262.1.48762 WP_000018262.1.48804 WP_000018262.1.48892 WP_000018262.1.48944 WP_000018262.1.4895 WP_000018262.1.48986 WP_000018262.1.48998 WP_000018262.1.49021 WP_000018262.1.49033 WP_000018262.1.49060 WP_000018262.1.49062 WP_000018262.1.49075 WP_000018262.1.49118 WP_000018262.1.49119 WP_000018262.1.49122 WP_000018262.1.49134 WP_000018262.1.49178 WP_000018262.1.492 WP_000018262.1.49208 WP_000018262.1.4934 WP_000018262.1.4936 WP_000018262.1.49385 WP_000018262.1.49407 WP_000018262.1.49408 WP_000018262.1.4951 WP_000018262.1.49511 WP_000018262.1.49597 WP_000018262.1.4960 WP_000018262.1.49601 WP_000018262.1.49635 WP_000018262.1.49636 WP_000018262.1.49656 WP_000018262.1.49692 WP_000018262.1.49752 WP_000018262.1.49759 WP_000018262.1.49765 WP_000018262.1.49776 WP_000018262.1.49824 WP_000018262.1.49840 WP_000018262.1.49845 WP_000018262.1.49873 WP_000018262.1.49881 WP_000018262.1.49901 WP_000018262.1.49955 WP_000018262.1.4996 WP_000018262.1.49973 WP_000018262.1.49975 WP_000018262.1.50000 WP_000018262.1.50034 WP_000018262.1.50083 WP_000018262.1.50094 WP_000018262.1.50107 WP_000018262.1.5015 WP_000018262.1.50169 WP_000018262.1.50184 WP_000018262.1.50200 WP_000018262.1.50209 WP_000018262.1.50234 WP_000018262.1.50244 WP_000018262.1.50263 WP_000018262.1.50318 WP_000018262.1.50396 WP_000018262.1.50422 WP_000018262.1.50436 WP_000018262.1.50530 WP_000018262.1.50532 WP_000018262.1.50580 WP_000018262.1.50582 WP_000018262.1.50604 WP_000018262.1.50628 WP_000018262.1.50637 WP_000018262.1.50649 WP_000018262.1.5065 WP_000018262.1.50685 WP_000018262.1.50709 WP_000018262.1.50739 WP_000018262.1.50743 WP_000018262.1.50785 WP_000018262.1.50797 WP_000018262.1.50824 WP_000018262.1.50836 WP_000018262.1.50843 WP_000018262.1.50849 WP_000018262.1.50870 WP_000018262.1.50911 WP_000018262.1.50915 WP_000018262.1.50921 WP_000018262.1.50965 WP_000018262.1.51012 WP_000018262.1.51032 WP_000018262.1.51054 WP_000018262.1.51075 WP_000018262.1.51079 WP_000018262.1.51083 WP_000018262.1.51089 WP_000018262.1.51094 WP_000018262.1.51110 WP_000018262.1.51143 WP_000018262.1.51145 WP_000018262.1.5116 WP_000018262.1.51205 WP_000018262.1.5122 WP_000018262.1.51238 WP_000018262.1.51243 WP_000018262.1.51357 WP_000018262.1.51367 WP_000018262.1.51379 WP_000018262.1.51417 WP_000018262.1.51444 WP_000018262.1.51449 WP_000018262.1.51467 WP_000018262.1.51475 WP_000018262.1.51476 WP_000018262.1.51511 WP_000018262.1.51528 WP_000018262.1.51541 WP_000018262.1.51554 WP_000018262.1.51562 WP_000018262.1.51602 WP_000018262.1.51626 WP_000018262.1.51635 WP_000018262.1.51658 WP_000018262.1.5166 WP_000018262.1.51674 WP_000018262.1.51684 WP_000018262.1.51742 WP_000018262.1.51776 WP_000018262.1.51820 WP_000018262.1.5188 WP_000018262.1.51908 WP_000018262.1.5191 WP_000018262.1.5196 WP_000018262.1.51960 WP_000018262.1.52018 WP_000018262.1.52042 WP_000018262.1.52055 WP_000018262.1.5207 WP_000018262.1.52107 WP_000018262.1.52143 WP_000018262.1.52155 WP_000018262.1.52231 WP_000018262.1.52245 WP_000018262.1.52268 WP_000018262.1.52315 WP_000018262.1.52335 WP_000018262.1.5244 WP_000018262.1.52443 WP_000018262.1.52453 WP_000018262.1.52512 WP_000018262.1.52515 WP_000018262.1.5256 WP_000018262.1.52561 WP_000018262.1.52570 WP_000018262.1.52581 WP_000018262.1.5261 WP_000018262.1.52666 WP_000018262.1.52681 WP_000018262.1.52726 WP_000018262.1.52759 WP_000018262.1.52783 WP_000018262.1.52786 WP_000018262.1.52842 WP_000018262.1.52854 WP_000018262.1.52879 WP_000018262.1.52953 WP_000018262.1.52972 WP_000018262.1.52975 WP_000018262.1.53004 WP_000018262.1.53042 WP_000018262.1.53079 WP_000018262.1.53135 WP_000018262.1.53166 WP_000018262.1.53212 WP_000018262.1.53235 WP_000018262.1.53241 WP_000018262.1.53243 WP_000018262.1.53268 WP_000018262.1.53291 WP_000018262.1.53295 WP_000018262.1.53297 WP_000018262.1.53337 WP_000018262.1.53339 WP_000018262.1.53380 WP_000018262.1.53384 WP_000018262.1.53404 WP_000018262.1.53405 WP_000018262.1.53429 WP_000018262.1.53440 WP_000018262.1.53449 WP_000018262.1.53581 WP_000018262.1.53596 WP_000018262.1.53600 WP_000018262.1.53611 WP_000018262.1.53612 WP_000018262.1.53619 WP_000018262.1.53640 WP_000018262.1.53652 WP_000018262.1.53660 WP_000018262.1.53677 WP_000018262.1.53684 WP_000018262.1.53697 WP_000018262.1.53699 WP_000018262.1.53735 WP_000018262.1.53744 WP_000018262.1.53756 WP_000018262.1.53761 WP_000018262.1.53785 WP_000018262.1.53798 WP_000018262.1.5385 WP_000018262.1.53891 WP_000018262.1.53929 WP_000018262.1.53957 WP_000018262.1.5396 WP_000018262.1.54001 WP_000018262.1.54009 WP_000018262.1.54020 WP_000018262.1.54021 WP_000018262.1.54064 WP_000018262.1.54066 WP_000018262.1.5411 WP_000018262.1.54154 WP_000018262.1.54221 WP_000018262.1.54303 WP_000018262.1.5431 WP_000018262.1.5432 WP_000018262.1.54372 WP_000018262.1.54376 WP_000018262.1.54412 WP_000018262.1.54457 WP_000018262.1.54475 WP_000018262.1.54483 WP_000018262.1.54501 WP_000018262.1.54570 WP_000018262.1.54582 WP_000018262.1.54610 WP_000018262.1.54650 WP_000018262.1.54656 WP_000018262.1.54658 WP_000018262.1.54738 WP_000018262.1.54762 WP_000018262.1.5477 WP_000018262.1.54793 WP_000018262.1.54805 WP_000018262.1.54813 WP_000018262.1.54862 WP_000018262.1.54922 WP_000018262.1.54932 WP_000018262.1.550 WP_000018262.1.55035 WP_000018262.1.55039 WP_000018262.1.55066 WP_000018262.1.55071 WP_000018262.1.55078 WP_000018262.1.55079 WP_000018262.1.55087 WP_000018262.1.55093 WP_000018262.1.55110 WP_000018262.1.55143 WP_000018262.1.55183 WP_000018262.1.55244 WP_000018262.1.5528 WP_000018262.1.55298 WP_000018262.1.5537 WP_000018262.1.55409 WP_000018262.1.55474 WP_000018262.1.55479 WP_000018262.1.55502 WP_000018262.1.55524 WP_000018262.1.55532 WP_000018262.1.55534 WP_000018262.1.55561 WP_000018262.1.55566 WP_000018262.1.55584 WP_000018262.1.55587 WP_000018262.1.55594 WP_000018262.1.55605 WP_000018262.1.55708 WP_000018262.1.55716 WP_000018262.1.55763 WP_000018262.1.55810 WP_000018262.1.55823 WP_000018262.1.55836 WP_000018262.1.55879 WP_000018262.1.55881 WP_000018262.1.55889 WP_000018262.1.55903 WP_000018262.1.55906 WP_000018262.1.56023 WP_000018262.1.56054 WP_000018262.1.5615 WP_000018262.1.56250 WP_000018262.1.56266 WP_000018262.1.56276 WP_000018262.1.56316 WP_000018262.1.56326 WP_000018262.1.56382 WP_000018262.1.56408 WP_000018262.1.56427 WP_000018262.1.56505 WP_000018262.1.56568 WP_000018262.1.56582 WP_000018262.1.56605 WP_000018262.1.56622 WP_000018262.1.56624 WP_000018262.1.56653 WP_000018262.1.56657 WP_000018262.1.56667 WP_000018262.1.56749 WP_000018262.1.56756 WP_000018262.1.56790 WP_000018262.1.56867 WP_000018262.1.56881 WP_000018262.1.5689 WP_000018262.1.56913 WP_000018262.1.56958 WP_000018262.1.56989 WP_000018262.1.56995 WP_000018262.1.57013 WP_000018262.1.57037 WP_000018262.1.57040 WP_000018262.1.57044 WP_000018262.1.5710 WP_000018262.1.57103 WP_000018262.1.57127 WP_000018262.1.57279 WP_000018262.1.57292 WP_000018262.1.57303 WP_000018262.1.57366 WP_000018262.1.57419 WP_000018262.1.57428 WP_000018262.1.57446 WP_000018262.1.57472 WP_000018262.1.57508 WP_000018262.1.5757 WP_000018262.1.57620 WP_000018262.1.57691 WP_000018262.1.57743 WP_000018262.1.57750 WP_000018262.1.57789 WP_000018262.1.5779 WP_000018262.1.57822 WP_000018262.1.57867 WP_000018262.1.57876 WP_000018262.1.57896 WP_000018262.1.57977 WP_000018262.1.58020 WP_000018262.1.5803 WP_000018262.1.58032 WP_000018262.1.58063 WP_000018262.1.5808 WP_000018262.1.581 WP_000018262.1.58166 WP_000018262.1.58189 WP_000018262.1.58197 WP_000018262.1.58211 WP_000018262.1.58227 WP_000018262.1.58264 WP_000018262.1.58268 WP_000018262.1.58296 WP_000018262.1.58331 WP_000018262.1.58333 WP_000018262.1.58342 WP_000018262.1.58348 WP_000018262.1.58376 WP_000018262.1.58480 WP_000018262.1.58483 WP_000018262.1.58519 WP_000018262.1.58553 WP_000018262.1.58563 WP_000018262.1.58591 WP_000018262.1.58607 WP_000018262.1.58645 WP_000018262.1.58653 WP_000018262.1.58670 WP_000018262.1.58679 WP_000018262.1.58697 WP_000018262.1.58761 WP_000018262.1.58811 WP_000018262.1.58825 WP_000018262.1.58829 WP_000018262.1.58841 WP_000018262.1.58843 WP_000018262.1.5887 WP_000018262.1.58877 WP_000018262.1.58948 WP_000018262.1.59007 WP_000018262.1.59018 WP_000018262.1.59028 WP_000018262.1.59033 WP_000018262.1.59081 WP_000018262.1.59109 WP_000018262.1.59117 WP_000018262.1.59141 WP_000018262.1.5916 WP_000018262.1.59160 WP_000018262.1.59201 WP_000018262.1.5921 WP_000018262.1.59229 WP_000018262.1.59257 WP_000018262.1.59307 WP_000018262.1.59308 WP_000018262.1.59365 WP_000018262.1.59370 WP_000018262.1.59382 WP_000018262.1.59442 WP_000018262.1.59482 WP_000018262.1.59514 WP_000018262.1.59552 WP_000018262.1.59558 WP_000018262.1.59608 WP_000018262.1.5964 WP_000018262.1.59721 WP_000018262.1.59740 WP_000018262.1.5976 WP_000018262.1.59766 WP_000018262.1.59774 WP_000018262.1.59785 WP_000018262.1.59867 WP_000018262.1.59884 WP_000018262.1.59903 WP_000018262.1.59935 WP_000018262.1.60014 WP_000018262.1.60032 WP_000018262.1.60073 WP_000018262.1.60148 WP_000018262.1.60174 WP_000018262.1.60177 WP_000018262.1.60204 WP_000018262.1.60210 WP_000018262.1.60309 WP_000018262.1.60385 WP_000018262.1.60391 WP_000018262.1.60420 WP_000018262.1.60423 WP_000018262.1.6044 WP_000018262.1.60450 WP_000018262.1.6046 WP_000018262.1.60485 WP_000018262.1.60521 WP_000018262.1.60532 WP_000018262.1.60541 WP_000018262.1.60574 WP_000018262.1.60592 WP_000018262.1.60596 WP_000018262.1.60601 WP_000018262.1.60618 WP_000018262.1.60621 WP_000018262.1.6063 WP_000018262.1.60637 WP_000018262.1.60642 WP_000018262.1.60731 WP_000018262.1.60756 WP_000018262.1.60799 WP_000018262.1.60812 WP_000018262.1.6088 WP_000018262.1.6092 WP_000018262.1.60924 WP_000018262.1.60973 WP_000018262.1.60977 WP_000018262.1.60993 WP_000018262.1.61088 WP_000018262.1.61155 WP_000018262.1.61164 WP_000018262.1.61182 WP_000018262.1.61217 WP_000018262.1.61220 WP_000018262.1.61250 WP_000018262.1.61301 WP_000018262.1.61302 WP_000018262.1.61307 WP_000018262.1.61348 WP_000018262.1.61365 WP_000018262.1.61372 WP_000018262.1.61378 WP_000018262.1.61396 WP_000018262.1.61423 WP_000018262.1.61451 WP_000018262.1.61471 WP_000018262.1.61489 WP_000018262.1.61495 WP_000018262.1.61506 WP_000018262.1.61513 WP_000018262.1.61531 WP_000018262.1.61541 WP_000018262.1.61546 WP_000018262.1.61548 WP_000018262.1.61550 WP_000018262.1.61605 WP_000018262.1.61606 WP_000018262.1.61611 WP_000018262.1.61627 WP_000018262.1.61647 WP_000018262.1.6177 WP_000018262.1.61785 WP_000018262.1.61837 WP_000018262.1.61839 WP_000018262.1.61863 WP_000018262.1.61896 WP_000018262.1.6192 WP_000018262.1.61959 WP_000018262.1.61992 WP_000018262.1.62000 WP_000018262.1.62001 WP_000018262.1.62022 WP_000018262.1.62039 WP_000018262.1.6207 WP_000018262.1.62118 WP_000018262.1.62134 WP_000018262.1.62137 WP_000018262.1.62151 WP_000018262.1.62173 WP_000018262.1.62190 WP_000018262.1.6226 WP_000018262.1.62287 WP_000018262.1.62293 WP_000018262.1.62315 WP_000018262.1.6235 WP_000018262.1.62391 WP_000018262.1.62432 WP_000018262.1.6244 WP_000018262.1.62445 WP_000018262.1.62518 WP_000018262.1.62532 WP_000018262.1.62540 WP_000018262.1.62566 WP_000018262.1.6258 WP_000018262.1.62585 WP_000018262.1.62643 WP_000018262.1.62670 WP_000018262.1.62777 WP_000018262.1.62779 WP_000018262.1.62814 WP_000018262.1.62821 WP_000018262.1.62833 WP_000018262.1.62867 WP_000018262.1.62900 WP_000018262.1.62921 WP_000018262.1.62944 WP_000018262.1.63034 WP_000018262.1.6309 WP_000018262.1.63128 WP_000018262.1.63149 WP_000018262.1.63225 WP_000018262.1.63235 WP_000018262.1.63238 WP_000018262.1.6324 WP_000018262.1.63245 WP_000018262.1.63311 WP_000018262.1.63328 WP_000018262.1.63375 WP_000018262.1.63431 WP_000018262.1.63442 WP_000018262.1.63503 WP_000018262.1.63506 WP_000018262.1.63543 WP_000018262.1.63675 WP_000018262.1.63724 WP_000018262.1.63741 WP_000018262.1.63761 WP_000018262.1.63767 WP_000018262.1.63778 WP_000018262.1.6382 WP_000018262.1.63846 WP_000018262.1.63859 WP_000018262.1.63882 WP_000018262.1.63891 WP_000018262.1.63919 WP_000018262.1.63927 WP_000018262.1.6393 WP_000018262.1.63935 WP_000018262.1.63936 WP_000018262.1.64002 WP_000018262.1.64090 WP_000018262.1.64132 WP_000018262.1.64135 WP_000018262.1.64184 WP_000018262.1.64203 WP_000018262.1.64245 WP_000018262.1.64246 WP_000018262.1.64255 WP_000018262.1.64262 WP_000018262.1.64313 WP_000018262.1.64316 WP_000018262.1.64322 WP_000018262.1.64342 WP_000018262.1.64423 WP_000018262.1.64464 WP_000018262.1.6447 WP_000018262.1.64481 WP_000018262.1.64490 WP_000018262.1.64576 WP_000018262.1.64696 WP_000018262.1.6470 WP_000018262.1.64719 WP_000018262.1.64739 WP_000018262.1.64750 WP_000018262.1.6478 WP_000018262.1.64785 WP_000018262.1.64851 WP_000018262.1.64855 WP_000018262.1.64906 WP_000018262.1.64913 WP_000018262.1.64925 WP_000018262.1.64993 WP_000018262.1.65062 WP_000018262.1.65063 WP_000018262.1.65091 WP_000018262.1.65107 WP_000018262.1.65119 WP_000018262.1.65133 WP_000018262.1.6515 WP_000018262.1.65159 WP_000018262.1.65235 WP_000018262.1.65265 WP_000018262.1.65268 WP_000018262.1.6529 WP_000018262.1.65318 WP_000018262.1.65319 WP_000018262.1.6532 WP_000018262.1.65362 WP_000018262.1.65368 WP_000018262.1.65371 WP_000018262.1.65380 WP_000018262.1.65442 WP_000018262.1.65489 WP_000018262.1.65492 WP_000018262.1.65542 WP_000018262.1.65690 WP_000018262.1.65702 WP_000018262.1.65721 WP_000018262.1.65743 WP_000018262.1.6577 WP_000018262.1.65773 WP_000018262.1.65789 WP_000018262.1.65792 WP_000018262.1.65797 WP_000018262.1.65799 WP_000018262.1.6580 WP_000018262.1.65806 WP_000018262.1.65829 WP_000018262.1.65853 WP_000018262.1.65896 WP_000018262.1.65936 WP_000018262.1.65944 WP_000018262.1.65982 WP_000018262.1.66045 WP_000018262.1.66115 WP_000018262.1.66135 WP_000018262.1.66166 WP_000018262.1.66207 WP_000018262.1.66274 WP_000018262.1.66309 WP_000018262.1.66310 WP_000018262.1.66470 WP_000018262.1.66477 WP_000018262.1.66490 WP_000018262.1.66497 WP_000018262.1.66500 WP_000018262.1.66517 WP_000018262.1.66536 WP_000018262.1.66571 WP_000018262.1.66595 WP_000018262.1.66620 WP_000018262.1.66637 WP_000018262.1.66640 WP_000018262.1.66674 WP_000018262.1.66688 WP_000018262.1.6679 WP_000018262.1.66797 WP_000018262.1.66813 WP_000018262.1.66861 WP_000018262.1.66914 WP_000018262.1.6695 WP_000018262.1.66956 WP_000018262.1.66966 WP_000018262.1.66995 WP_000018262.1.67080 WP_000018262.1.67114 WP_000018262.1.67115 WP_000018262.1.67206 WP_000018262.1.67274 WP_000018262.1.673 WP_000018262.1.67327 WP_000018262.1.67353 WP_000018262.1.67358 WP_000018262.1.67401 WP_000018262.1.67443 WP_000018262.1.67458 WP_000018262.1.67469 WP_000018262.1.67508 WP_000018262.1.67557 WP_000018262.1.67565 WP_000018262.1.67655 WP_000018262.1.67684 WP_000018262.1.67697 WP_000018262.1.67739 WP_000018262.1.67748 WP_000018262.1.67773 WP_000018262.1.67797 WP_000018262.1.67840 WP_000018262.1.67881 WP_000018262.1.6795 WP_000018262.1.67950 WP_000018262.1.67967 WP_000018262.1.67994 WP_000018262.1.68002 WP_000018262.1.68017 WP_000018262.1.68072 WP_000018262.1.68077 WP_000018262.1.68084 WP_000018262.1.68192 WP_000018262.1.6821 WP_000018262.1.68238 WP_000018262.1.6826 WP_000018262.1.68267 WP_000018262.1.68287 WP_000018262.1.68363 WP_000018262.1.68377 WP_000018262.1.68381 WP_000018262.1.68431 WP_000018262.1.68503 WP_000018262.1.68560 WP_000018262.1.68578 WP_000018262.1.68596 WP_000018262.1.68605 WP_000018262.1.68622 WP_000018262.1.68721 WP_000018262.1.68755 WP_000018262.1.68812 WP_000018262.1.68814 WP_000018262.1.68819 WP_000018262.1.68822 WP_000018262.1.68851 WP_000018262.1.68853 WP_000018262.1.68963 WP_000018262.1.69005 WP_000018262.1.69017 WP_000018262.1.69037 WP_000018262.1.69063 WP_000018262.1.69073 WP_000018262.1.69116 WP_000018262.1.69148 WP_000018262.1.69215 WP_000018262.1.69230 WP_000018262.1.69234 WP_000018262.1.69241 WP_000018262.1.6925 WP_000018262.1.69285 WP_000018262.1.69292 WP_000018262.1.69344 WP_000018262.1.69420 WP_000018262.1.69431 WP_000018262.1.69482 WP_000018262.1.69499 WP_000018262.1.69512 WP_000018262.1.69549 WP_000018262.1.69560 WP_000018262.1.69608 WP_000018262.1.69623 WP_000018262.1.69626 WP_000018262.1.69641 WP_000018262.1.69670 WP_000018262.1.69695 WP_000018262.1.69715 WP_000018262.1.69752 WP_000018262.1.69798 WP_000018262.1.69863 WP_000018262.1.69866 WP_000018262.1.69869 WP_000018262.1.6988 WP_000018262.1.69905 WP_000018262.1.69917 WP_000018262.1.69940 WP_000018262.1.69954 WP_000018262.1.70020 WP_000018262.1.70046 WP_000018262.1.7008 WP_000018262.1.70150 WP_000018262.1.70156 WP_000018262.1.70192 WP_000018262.1.70221 WP_000018262.1.70224 WP_000018262.1.70233 WP_000018262.1.70275 WP_000018262.1.70277 WP_000018262.1.70298 WP_000018262.1.70360 WP_000018262.1.70400 WP_000018262.1.70430 WP_000018262.1.7047 WP_000018262.1.70486 WP_000018262.1.70490 WP_000018262.1.70524 WP_000018262.1.70528 WP_000018262.1.70532 WP_000018262.1.70535 WP_000018262.1.70536 WP_000018262.1.70538 WP_000018262.1.7057 WP_000018262.1.70766 WP_000018262.1.70802 WP_000018262.1.70828 WP_000018262.1.70838 WP_000018262.1.70851 WP_000018262.1.70867 WP_000018262.1.70876 WP_000018262.1.70877 WP_000018262.1.70988 WP_000018262.1.71014 WP_000018262.1.71051 WP_000018262.1.71053 WP_000018262.1.71065 WP_000018262.1.71084 WP_000018262.1.71093 WP_000018262.1.7112 WP_000018262.1.71178 WP_000018262.1.71195 WP_000018262.1.71206 WP_000018262.1.71360 WP_000018262.1.71415 WP_000018262.1.71436 WP_000018262.1.71551 WP_000018262.1.71571 WP_000018262.1.71574 WP_000018262.1.71605 WP_000018262.1.71622 WP_000018262.1.71659 WP_000018262.1.7167 WP_000018262.1.71700 WP_000018262.1.71773 WP_000018262.1.71818 WP_000018262.1.71849 WP_000018262.1.71869 WP_000018262.1.71870 WP_000018262.1.71879 WP_000018262.1.7188 WP_000018262.1.71880 WP_000018262.1.71883 WP_000018262.1.71897 WP_000018262.1.71905 WP_000018262.1.72009 WP_000018262.1.72043 WP_000018262.1.72082 WP_000018262.1.72088 WP_000018262.1.72095 WP_000018262.1.72096 WP_000018262.1.72108 WP_000018262.1.72135 WP_000018262.1.72147 WP_000018262.1.72242 WP_000018262.1.72309 WP_000018262.1.72329 WP_000018262.1.72368 WP_000018262.1.72454 WP_000018262.1.7247 WP_000018262.1.72472 WP_000018262.1.72474 WP_000018262.1.72542 WP_000018262.1.72610 WP_000018262.1.7268 WP_000018262.1.72736 WP_000018262.1.72785 WP_000018262.1.72796 WP_000018262.1.72854 WP_000018262.1.72855 WP_000018262.1.7289 WP_000018262.1.72900 WP_000018262.1.72963 WP_000018262.1.7299 WP_000018262.1.7300 WP_000018262.1.73008 WP_000018262.1.73012 WP_000018262.1.73027 WP_000018262.1.73051 WP_000018262.1.73064 WP_000018262.1.73071 WP_000018262.1.73099 WP_000018262.1.73101 WP_000018262.1.73133 WP_000018262.1.73178 WP_000018262.1.732 WP_000018262.1.73209 WP_000018262.1.73214 WP_000018262.1.73226 WP_000018262.1.73227 WP_000018262.1.73320 WP_000018262.1.73322 WP_000018262.1.73369 WP_000018262.1.73397 WP_000018262.1.73433 WP_000018262.1.73500 WP_000018262.1.73509 WP_000018262.1.7352 WP_000018262.1.73567 WP_000018262.1.7357 WP_000018262.1.73578 WP_000018262.1.73622 WP_000018262.1.73666 WP_000018262.1.73716 WP_000018262.1.73726 WP_000018262.1.73796 WP_000018262.1.73812 WP_000018262.1.73890 WP_000018262.1.73903 WP_000018262.1.73912 WP_000018262.1.73914 WP_000018262.1.73923 WP_000018262.1.7397 WP_000018262.1.73982 WP_000018262.1.74014 WP_000018262.1.74033 WP_000018262.1.74069 WP_000018262.1.74105 WP_000018262.1.74127 WP_000018262.1.74128 WP_000018262.1.74139 WP_000018262.1.74206 WP_000018262.1.74208 WP_000018262.1.74260 WP_000018262.1.74314 WP_000018262.1.74330 WP_000018262.1.74364 WP_000018262.1.74387 WP_000018262.1.74399 WP_000018262.1.74437 WP_000018262.1.74448 WP_000018262.1.7449 WP_000018262.1.74496 WP_000018262.1.74508 WP_000018262.1.74582 WP_000018262.1.74607 WP_000018262.1.74618 WP_000018262.1.7466 WP_000018262.1.7468 WP_000018262.1.74751 WP_000018262.1.74795 WP_000018262.1.74796 WP_000018262.1.7488 WP_000018262.1.74891 WP_000018262.1.74906 WP_000018262.1.74928 WP_000018262.1.7503 WP_000018262.1.75031 WP_000018262.1.75049 WP_000018262.1.7505 WP_000018262.1.75053 WP_000018262.1.75074 WP_000018262.1.75096 WP_000018262.1.75099 WP_000018262.1.75102 WP_000018262.1.75123 WP_000018262.1.75154 WP_000018262.1.75191 WP_000018262.1.75222 WP_000018262.1.75260 WP_000018262.1.75302 WP_000018262.1.75312 WP_000018262.1.75314 WP_000018262.1.75336 WP_000018262.1.75354 WP_000018262.1.75370 WP_000018262.1.75401 WP_000018262.1.75427 WP_000018262.1.75429 WP_000018262.1.75464 WP_000018262.1.75469 WP_000018262.1.7548 WP_000018262.1.75493 WP_000018262.1.75500 WP_000018262.1.75511 WP_000018262.1.75522 WP_000018262.1.75534 WP_000018262.1.75558 WP_000018262.1.75584 WP_000018262.1.75601 WP_000018262.1.75632 WP_000018262.1.75648 WP_000018262.1.75675 WP_000018262.1.75709 WP_000018262.1.7573 WP_000018262.1.75755 WP_000018262.1.75759 WP_000018262.1.75787 WP_000018262.1.75817 WP_000018262.1.75845 WP_000018262.1.75877 WP_000018262.1.75899 WP_000018262.1.75904 WP_000018262.1.75982 WP_000018262.1.75996 WP_000018262.1.76017 WP_000018262.1.76051 WP_000018262.1.76091 WP_000018262.1.76165 WP_000018262.1.76195 WP_000018262.1.76249 WP_000018262.1.76263 WP_000018262.1.76265 WP_000018262.1.76285 WP_000018262.1.76293 WP_000018262.1.76375 WP_000018262.1.76393 WP_000018262.1.76440 WP_000018262.1.76453 WP_000018262.1.76458 WP_000018262.1.76492 WP_000018262.1.76499 WP_000018262.1.76530 WP_000018262.1.76591 WP_000018262.1.76594 WP_000018262.1.76649 WP_000018262.1.76650 WP_000018262.1.76667 WP_000018262.1.7673 WP_000018262.1.76731 WP_000018262.1.76764 WP_000018262.1.76777 WP_000018262.1.76780 WP_000018262.1.7679 WP_000018262.1.76857 WP_000018262.1.76862 WP_000018262.1.76868 WP_000018262.1.76874 WP_000018262.1.76892 WP_000018262.1.76927 WP_000018262.1.76972 WP_000018262.1.76980 WP_000018262.1.77044 WP_000018262.1.77088 WP_000018262.1.77094 WP_000018262.1.77103 WP_000018262.1.77123 WP_000018262.1.77130 WP_000018262.1.77167 WP_000018262.1.77172 WP_000018262.1.77195 WP_000018262.1.77197 WP_000018262.1.77223 WP_000018262.1.7725 WP_000018262.1.77278 WP_000018262.1.77309 WP_000018262.1.77318 WP_000018262.1.77353 WP_000018262.1.77373 WP_000018262.1.77378 WP_000018262.1.77399 WP_000018262.1.7741 WP_000018262.1.77413 WP_000018262.1.77434 WP_000018262.1.77439 WP_000018262.1.77456 WP_000018262.1.77505 WP_000018262.1.7751 WP_000018262.1.77535 WP_000018262.1.77585 WP_000018262.1.77637 WP_000018262.1.77659 WP_000018262.1.77731 WP_000018262.1.77747 WP_000018262.1.77755 WP_000018262.1.77765 WP_000018262.1.77770 WP_000018262.1.77780 WP_000018262.1.77785 WP_000018262.1.77789 WP_000018262.1.77808 WP_000018262.1.77847 WP_000018262.1.77872 WP_000018262.1.77947 WP_000018262.1.78025 WP_000018262.1.78030 WP_000018262.1.78045 WP_000018262.1.78079 WP_000018262.1.7812 WP_000018262.1.78129 WP_000018262.1.78139 WP_000018262.1.78147 WP_000018262.1.78241 WP_000018262.1.78253 WP_000018262.1.7828 WP_000018262.1.78312 WP_000018262.1.78349 WP_000018262.1.7838 WP_000018262.1.78457 WP_000018262.1.7846 WP_000018262.1.78535 WP_000018262.1.78690 WP_000018262.1.78720 WP_000018262.1.78724 WP_000018262.1.78762 WP_000018262.1.78796 WP_000018262.1.78828 WP_000018262.1.78876 WP_000018262.1.78887 WP_000018262.1.78890 WP_000018262.1.78915 WP_000018262.1.78967 WP_000018262.1.79008 WP_000018262.1.79079 WP_000018262.1.79104 WP_000018262.1.79124 WP_000018262.1.79134 WP_000018262.1.79138 WP_000018262.1.79157 WP_000018262.1.7919 WP_000018262.1.7920 WP_000018262.1.79228 WP_000018262.1.7924 WP_000018262.1.79245 WP_000018262.1.79298 WP_000018262.1.79329 WP_000018262.1.79338 WP_000018262.1.79410 WP_000018262.1.79496 WP_000018262.1.79527 WP_000018262.1.7954 WP_000018262.1.79546 WP_000018262.1.79555 WP_000018262.1.7959 WP_000018262.1.79594 WP_000018262.1.79637 WP_000018262.1.79669 WP_000018262.1.79671 WP_000018262.1.79688 WP_000018262.1.79690 WP_000018262.1.79732 WP_000018262.1.79746 WP_000018262.1.79761 WP_000018262.1.79786 WP_000018262.1.79809 WP_000018262.1.79830 WP_000018262.1.79835 WP_000018262.1.80005 WP_000018262.1.80070 WP_000018262.1.80074 WP_000018262.1.8015 WP_000018262.1.80190 WP_000018262.1.80191 WP_000018262.1.80196 WP_000018262.1.80200 WP_000018262.1.80207 WP_000018262.1.80228 WP_000018262.1.80231 WP_000018262.1.80256 WP_000018262.1.80268 WP_000018262.1.80321 WP_000018262.1.80328 WP_000018262.1.8041 WP_000018262.1.80435 WP_000018262.1.80475 WP_000018262.1.8048 WP_000018262.1.80495 WP_000018262.1.80597 WP_000018262.1.80611 WP_000018262.1.80619 WP_000018262.1.80672 WP_000018262.1.80689 WP_000018262.1.80758 WP_000018262.1.80774 WP_000018262.1.80775 WP_000018262.1.80856 WP_000018262.1.80885 WP_000018262.1.80919 WP_000018262.1.80934 WP_000018262.1.80951 WP_000018262.1.80990 WP_000018262.1.8101 WP_000018262.1.81012 WP_000018262.1.81090 WP_000018262.1.81117 WP_000018262.1.81179 WP_000018262.1.81183 WP_000018262.1.81201 WP_000018262.1.81236 WP_000018262.1.81256 WP_000018262.1.81296 WP_000018262.1.81309 WP_000018262.1.81314 WP_000018262.1.81343 WP_000018262.1.81360 WP_000018262.1.81367 WP_000018262.1.81382 WP_000018262.1.81390 WP_000018262.1.81398 WP_000018262.1.81473 WP_000018262.1.81481 WP_000018262.1.81483 WP_000018262.1.81493 WP_000018262.1.81498 WP_000018262.1.8154 WP_000018262.1.81545 WP_000018262.1.81585 WP_000018262.1.81586 WP_000018262.1.81630 WP_000018262.1.81663 WP_000018262.1.81745 WP_000018262.1.81775 WP_000018262.1.81801 WP_000018262.1.81807 WP_000018262.1.81890 WP_000018262.1.81894 WP_000018262.1.81929 WP_000018262.1.81959 WP_000018262.1.81967 WP_000018262.1.81984 WP_000018262.1.82016 WP_000018262.1.82029 WP_000018262.1.82033 WP_000018262.1.82049 WP_000018262.1.82085 WP_000018262.1.82094 WP_000018262.1.82181 WP_000018262.1.82191 WP_000018262.1.8221 WP_000018262.1.82255 WP_000018262.1.82284 WP_000018262.1.82302 WP_000018262.1.82338 WP_000018262.1.82345 WP_000018262.1.82392 WP_000018262.1.82422 WP_000018262.1.82423 WP_000018262.1.82437 WP_000018262.1.82459 WP_000018262.1.8248 WP_000018262.1.82502 WP_000018262.1.82505 WP_000018262.1.82552 WP_000018262.1.82557 WP_000018262.1.82563 WP_000018262.1.8257 WP_000018262.1.82600 WP_000018262.1.82650 WP_000018262.1.82652 WP_000018262.1.82693 WP_000018262.1.82699 WP_000018262.1.82702 WP_000018262.1.82733 WP_000018262.1.82737 WP_000018262.1.8275 WP_000018262.1.82758 WP_000018262.1.8276 WP_000018262.1.82777 WP_000018262.1.82783 WP_000018262.1.82792 WP_000018262.1.82827 WP_000018262.1.8283 WP_000018262.1.82840 WP_000018262.1.82845 WP_000018262.1.82847 WP_000018262.1.82877 WP_000018262.1.82885 WP_000018262.1.82900 WP_000018262.1.82921 WP_000018262.1.82958 WP_000018262.1.82994 WP_000018262.1.83064 WP_000018262.1.83067 WP_000018262.1.83094 WP_000018262.1.83115 WP_000018262.1.83123 WP_000018262.1.83135 WP_000018262.1.8316 WP_000018262.1.83169 WP_000018262.1.83174 WP_000018262.1.83189 WP_000018262.1.83227 WP_000018262.1.83231 WP_000018262.1.83241 WP_000018262.1.83242 WP_000018262.1.83281 WP_000018262.1.83306 WP_000018262.1.83311 WP_000018262.1.83335 WP_000018262.1.83371 WP_000018262.1.83443 WP_000018262.1.83455 WP_000018262.1.83456 WP_000018262.1.8347 WP_000018262.1.83518 WP_000018262.1.8352 WP_000018262.1.83527 WP_000018262.1.83577 WP_000018262.1.83578 WP_000018262.1.83587 WP_000018262.1.83613 WP_000018262.1.83636 WP_000018262.1.83702 WP_000018262.1.83713 WP_000018262.1.83719 WP_000018262.1.83752 WP_000018262.1.83840 WP_000018262.1.83846 WP_000018262.1.83863 WP_000018262.1.83866 WP_000018262.1.83899 WP_000018262.1.83910 WP_000018262.1.83922 WP_000018262.1.83961 WP_000018262.1.83962 WP_000018262.1.83974 WP_000018262.1.8398 WP_000018262.1.84013 WP_000018262.1.84056 WP_000018262.1.84062 WP_000018262.1.84065 WP_000018262.1.84095 WP_000018262.1.84111 WP_000018262.1.84125 WP_000018262.1.84147 WP_000018262.1.84211 WP_000018262.1.84220 WP_000018262.1.84263 WP_000018262.1.84363 WP_000018262.1.84477 WP_000018262.1.84500 WP_000018262.1.84521 WP_000018262.1.84530 WP_000018262.1.84542 WP_000018262.1.84664 WP_000018262.1.84672 WP_000018262.1.84785 WP_000018262.1.84827 WP_000018262.1.84842 WP_000018262.1.8486 WP_000018262.1.84897 WP_000018262.1.84910 WP_000018262.1.84955 WP_000018262.1.84991 WP_000018262.1.8500 WP_000018262.1.85019 WP_000018262.1.85033 WP_000018262.1.85064 WP_000018262.1.8507 WP_000018262.1.85093 WP_000018262.1.85095 WP_000018262.1.8510 WP_000018262.1.85103 WP_000018262.1.85111 WP_000018262.1.85114 WP_000018262.1.85171 WP_000018262.1.85195 WP_000018262.1.85212 WP_000018262.1.85215 WP_000018262.1.85221 WP_000018262.1.85222 WP_000018262.1.85233 WP_000018262.1.85250 WP_000018262.1.85258 WP_000018262.1.85286 WP_000018262.1.85392 WP_000018262.1.85427 WP_000018262.1.85526 WP_000018262.1.85548 WP_000018262.1.85581 WP_000018262.1.85609 WP_000018262.1.85612 WP_000018262.1.85659 WP_000018262.1.8569 WP_000018262.1.85748 WP_000018262.1.85750 WP_000018262.1.85826 WP_000018262.1.85849 WP_000018262.1.85896 WP_000018262.1.8590 WP_000018262.1.85918 WP_000018262.1.85942 WP_000018262.1.85947 WP_000018262.1.85973 WP_000018262.1.86061 WP_000018262.1.86075 WP_000018262.1.86081 WP_000018262.1.8612 WP_000018262.1.86211 WP_000018262.1.86223 WP_000018262.1.86282 WP_000018262.1.86296 WP_000018262.1.86297 WP_000018262.1.86312 WP_000018262.1.86403 WP_000018262.1.86407 WP_000018262.1.86423 WP_000018262.1.86440 WP_000018262.1.86445 WP_000018262.1.86496 WP_000018262.1.86503 WP_000018262.1.86507 WP_000018262.1.86529 WP_000018262.1.86539 WP_000018262.1.86612 WP_000018262.1.86614 WP_000018262.1.86632 WP_000018262.1.86636 WP_000018262.1.86685 WP_000018262.1.86689 WP_000018262.1.86746 WP_000018262.1.86751 WP_000018262.1.86798 WP_000018262.1.86866 WP_000018262.1.86875 WP_000018262.1.86880 WP_000018262.1.86887 WP_000018262.1.87065 WP_000018262.1.8708 WP_000018262.1.87138 WP_000018262.1.87174 WP_000018262.1.87186 WP_000018262.1.87200 WP_000018262.1.8724 WP_000018262.1.87248 WP_000018262.1.87289 WP_000018262.1.87297 WP_000018262.1.8734 WP_000018262.1.87347 WP_000018262.1.87383 WP_000018262.1.87421 WP_000018262.1.8747 WP_000018262.1.87510 WP_000018262.1.87550 WP_000018262.1.87575 WP_000018262.1.87592 WP_000018262.1.87604 WP_000018262.1.87664 WP_000018262.1.87699 WP_000018262.1.877 WP_000018262.1.87719 WP_000018262.1.87731 WP_000018262.1.87774 WP_000018262.1.87792 WP_000018262.1.87829 WP_000018262.1.87872 WP_000018262.1.87901 WP_000018262.1.87909 WP_000018262.1.87910 WP_000018262.1.87946 WP_000018262.1.87961 WP_000018262.1.87971 WP_000018262.1.8799 WP_000018262.1.87993 WP_000018262.1.87998 WP_000018262.1.88008 WP_000018262.1.88033 WP_000018262.1.88054 WP_000018262.1.88084 WP_000018262.1.88167 WP_000018262.1.88203 WP_000018262.1.88206 WP_000018262.1.88218 WP_000018262.1.88224 WP_000018262.1.88225 WP_000018262.1.8823 WP_000018262.1.88280 WP_000018262.1.88387 WP_000018262.1.88433 WP_000018262.1.88519 WP_000018262.1.88523 WP_000018262.1.88544 WP_000018262.1.88586 WP_000018262.1.88602 WP_000018262.1.88669 WP_000018262.1.88693 WP_000018262.1.88697 WP_000018262.1.88722 WP_000018262.1.88724 WP_000018262.1.8876 WP_000018262.1.88811 WP_000018262.1.88825 WP_000018262.1.88869 WP_000018262.1.88963 WP_000018262.1.89029 WP_000018262.1.89059 WP_000018262.1.89123 WP_000018262.1.89161 WP_000018262.1.89208 WP_000018262.1.89210 WP_000018262.1.89282 WP_000018262.1.89294 WP_000018262.1.89346 WP_000018262.1.89369 WP_000018262.1.89370 WP_000018262.1.89375 WP_000018262.1.89444 WP_000018262.1.89489 WP_000018262.1.89532 WP_000018262.1.89563 WP_000018262.1.89565 WP_000018262.1.89640 WP_000018262.1.89654 WP_000018262.1.89681 WP_000018262.1.89684 WP_000018262.1.89708 WP_000018262.1.8973 WP_000018262.1.8975 WP_000018262.1.89757 WP_000018262.1.89850 WP_000018262.1.89858 WP_000018262.1.89907 WP_000018262.1.89913 WP_000018262.1.89982 WP_000018262.1.90028 WP_000018262.1.90071 WP_000018262.1.90143 WP_000018262.1.90163 WP_000018262.1.90178 WP_000018262.1.9018 WP_000018262.1.90186 WP_000018262.1.90197 WP_000018262.1.90202 WP_000018262.1.90261 WP_000018262.1.90281 WP_000018262.1.90304 WP_000018262.1.90313 WP_000018262.1.90356 WP_000018262.1.90385 WP_000018262.1.90396 WP_000018262.1.90463 WP_000018262.1.90501 WP_000018262.1.90502 WP_000018262.1.90535 WP_000018262.1.90565 WP_000018262.1.90577 WP_000018262.1.90606 WP_000018262.1.90618 WP_000018262.1.90663 WP_000018262.1.90693 WP_000018262.1.90712 WP_000018262.1.90727 WP_000018262.1.90762 WP_000018262.1.9090 WP_000018262.1.90900 WP_000018262.1.90936 WP_000018262.1.90957 WP_000018262.1.90965 WP_000018262.1.90974 WP_000018262.1.91015 WP_000018262.1.91024 WP_000018262.1.91037 WP_000018262.1.91079 WP_000018262.1.91125 WP_000018262.1.91127 WP_000018262.1.91131 WP_000018262.1.9115 WP_000018262.1.91154 WP_000018262.1.91172 WP_000018262.1.91193 WP_000018262.1.91269 WP_000018262.1.91292 WP_000018262.1.91339 WP_000018262.1.91358 WP_000018262.1.91383 WP_000018262.1.91407 WP_000018262.1.91412 WP_000018262.1.91432 WP_000018262.1.91468 WP_000018262.1.91478 WP_000018262.1.91545 WP_000018262.1.91562 WP_000018262.1.9162 WP_000018262.1.91650 WP_000018262.1.91656 WP_000018262.1.91705 WP_000018262.1.91714 WP_000018262.1.91719 WP_000018262.1.91821 WP_000018262.1.91839 WP_000018262.1.9184 WP_000018262.1.91878 WP_000018262.1.91881 WP_000018262.1.91902 WP_000018262.1.91923 WP_000018262.1.91927 WP_000018262.1.91934 WP_000018262.1.91972 WP_000018262.1.91985 WP_000018262.1.92032 WP_000018262.1.9207 WP_000018262.1.92077 WP_000018262.1.92086 WP_000018262.1.92092 WP_000018262.1.92103 WP_000018262.1.92121 WP_000018262.1.92124 WP_000018262.1.92166 WP_000018262.1.92167 WP_000018262.1.92176 WP_000018262.1.92177 WP_000018262.1.92178 WP_000018262.1.92225 WP_000018262.1.92261 WP_000018262.1.92298 WP_000018262.1.92301 WP_000018262.1.92342 WP_000018262.1.92344 WP_000018262.1.92351 WP_000018262.1.92353 WP_000018262.1.92457 WP_000018262.1.92464 WP_000018262.1.92487 WP_000018262.1.92563 WP_000018262.1.9260 WP_000018262.1.92656 WP_000018262.1.92724 WP_000018262.1.92740 WP_000018262.1.92835 WP_000018262.1.92837 WP_000018262.1.92854 WP_000018262.1.92866 WP_000018262.1.92872 WP_000018262.1.92906 WP_000018262.1.92940 WP_000018262.1.92967 WP_000018262.1.92969 WP_000018262.1.9297 WP_000018262.1.92973 WP_000018262.1.93084 WP_000018262.1.93126 WP_000018262.1.93129 WP_000018262.1.93135 WP_000018262.1.93154 WP_000018262.1.93156 WP_000018262.1.93158 WP_000018262.1.93173 WP_000018262.1.93178 WP_000018262.1.93238 WP_000018262.1.93253 WP_000018262.1.93262 WP_000018262.1.93279 WP_000018262.1.93285 WP_000018262.1.93294 WP_000018262.1.93314 WP_000018262.1.9332 WP_000018262.1.93347 WP_000018262.1.9339 WP_000018262.1.93401 WP_000018262.1.93452 WP_000018262.1.93462 WP_000018262.1.9347 WP_000018262.1.93479 WP_000018262.1.93489 WP_000018262.1.93550 WP_000018262.1.93592 WP_000018262.1.93609 WP_000018262.1.9364 WP_000018262.1.93641 WP_000018262.1.9369 WP_000018262.1.93700 WP_000018262.1.93701 WP_000018262.1.93703 WP_000018262.1.93785 WP_000018262.1.93805 WP_000018262.1.93811 WP_000018262.1.93878 WP_000018262.1.93906 WP_000018262.1.93915 WP_000018262.1.94101 WP_000018262.1.94139 WP_000018262.1.9414 WP_000018262.1.94145 WP_000018262.1.94148 WP_000018262.1.94159 WP_000018262.1.94192 WP_000018262.1.94247 WP_000018262.1.94263 WP_000018262.1.94316 WP_000018262.1.94357 WP_000018262.1.94425 WP_000018262.1.94442 WP_000018262.1.94459 WP_000018262.1.94466 WP_000018262.1.94476 WP_000018262.1.945 WP_000018262.1.9452 WP_000018262.1.94526 WP_000018262.1.94558 WP_000018262.1.94570 WP_000018262.1.94577 WP_000018262.1.94604 WP_000018262.1.94643 WP_000018262.1.94644 WP_000018262.1.94651 WP_000018262.1.94689 WP_000018262.1.94810 WP_000018262.1.94811 WP_000018262.1.94876 WP_000018262.1.94885 WP_000018262.1.94940 WP_000018262.1.94954 WP_000018262.1.95041 WP_000018262.1.95059 WP_000018262.1.95069 WP_000018262.1.95073 WP_000018262.1.9508 WP_000018262.1.95098 WP_000018262.1.95106 WP_000018262.1.95113 WP_000018262.1.95153 WP_000018262.1.9518 WP_000018262.1.95209 WP_000018262.1.95219 WP_000018262.1.95276 WP_000018262.1.9528 WP_000018262.1.95312 WP_000018262.1.95356 WP_000018262.1.95376 WP_000018262.1.95413 WP_000018262.1.95458 WP_000018262.1.95532 WP_000018262.1.95642 WP_000018262.1.95688 WP_000018262.1.95707 WP_000018262.1.95722 WP_000018262.1.95740 WP_000018262.1.95765 WP_000018262.1.95769 WP_000018262.1.95778 WP_000018262.1.95807 WP_000018262.1.95868 WP_000018262.1.95904 WP_000018262.1.95925 WP_000018262.1.95933 WP_000018262.1.95936 WP_000018262.1.95942 WP_000018262.1.95956 WP_000018262.1.96003 WP_000018262.1.96007 WP_000018262.1.96011 WP_000018262.1.96048 WP_000018262.1.96096 WP_000018262.1.96100 WP_000018262.1.96106 WP_000018262.1.9611 WP_000018262.1.96111 WP_000018262.1.96117 WP_000018262.1.9612 WP_000018262.1.96138 WP_000018262.1.9615 WP_000018262.1.96178 WP_000018262.1.96189 WP_000018262.1.9620 WP_000018262.1.96231 WP_000018262.1.96277 WP_000018262.1.96292 WP_000018262.1.96321 WP_000018262.1.96336 WP_000018262.1.96397 WP_000018262.1.96421 WP_000018262.1.96464 WP_000018262.1.96517 WP_000018262.1.96565 WP_000018262.1.96582 WP_000018262.1.96595 WP_000018262.1.96601 WP_000018262.1.96619 WP_000018262.1.96636 WP_000018262.1.967 WP_000018262.1.96703 WP_000018262.1.96709 WP_000018262.1.96749 WP_000018262.1.96772 WP_000018262.1.96781 WP_000018262.1.96819 WP_000018262.1.96875 WP_000018262.1.96888 WP_000018262.1.96889 WP_000018262.1.96961 WP_000018262.1.96974 WP_000018262.1.96994 WP_000018262.1.97035 WP_000018262.1.97040 WP_000018262.1.97048 WP_000018262.1.9705 WP_000018262.1.97051 WP_000018262.1.97066 WP_000018262.1.97070 WP_000018262.1.97073 WP_000018262.1.97159 WP_000018262.1.97162 WP_000018262.1.9730 WP_000018262.1.97308 WP_000018262.1.97362 WP_000018262.1.97383 WP_000018262.1.97479 WP_000018262.1.97485 WP_000018262.1.97524 WP_000018262.1.97526 WP_000018262.1.97553 WP_000018262.1.97582 WP_000018262.1.97595 WP_000018262.1.9760 WP_000018262.1.97644 WP_000018262.1.97657 WP_000018262.1.97702 WP_000018262.1.97808 WP_000018262.1.97824 WP_000018262.1.97829 WP_000018262.1.97831 WP_000018262.1.97856 WP_000018262.1.97859 WP_000018262.1.97862 WP_000018262.1.97866 WP_000018262.1.97875 WP_000018262.1.97876 WP_000018262.1.97878 WP_000018262.1.97879 WP_000018262.1.97880 WP_000018262.1.97921 WP_000018262.1.97925 WP_000018262.1.97944 WP_000018262.1.97980 WP_000018262.1.98045 WP_000018262.1.98057 WP_000018262.1.98074 WP_000018262.1.98159 WP_000018262.1.98192 WP_000018262.1.98196 WP_000018262.1.98198 WP_000018262.1.98217 WP_000018262.1.98234 WP_000018262.1.98265 WP_000018262.1.98290 WP_000018262.1.983 WP_000018262.1.98388 WP_000018262.1.98399 WP_000018262.1.98435 WP_000018262.1.98460 WP_000018262.1.98475 WP_000018262.1.98539 WP_000018262.1.98623 WP_000018262.1.98632 WP_000018262.1.98635 WP_000018262.1.98647 WP_000018262.1.98679 WP_000018262.1.98714 WP_000018262.1.98732 WP_000018262.1.98740 WP_000018262.1.98747 WP_000018262.1.98755 WP_000018262.1.98781 WP_000018262.1.9879 WP_000018262.1.98828 WP_000018262.1.98833 WP_000018262.1.98851 WP_000018262.1.98855 WP_000018262.1.98859 WP_000018262.1.98862 WP_000018262.1.98893 WP_000018262.1.98905 WP_000018262.1.98941 WP_000018262.1.98943 WP_000018262.1.9895 WP_000018262.1.98957 WP_000018262.1.98961 WP_000018262.1.98989 WP_000018262.1.9902 WP_000018262.1.99096 WP_000018262.1.99138 WP_000018262.1.99143 WP_000018262.1.9915 WP_000018262.1.99203 WP_000018262.1.99223 WP_000018262.1.99225 WP_000018262.1.99291 WP_000018262.1.99314 WP_000018262.1.99358 WP_000018262.1.99436 WP_000018262.1.99465 WP_000018262.1.99478 WP_000018262.1.99554 WP_000018262.1.99565 WP_000018262.1.99596 WP_000018262.1.99600 WP_000018262.1.99611 WP_000018262.1.99623 WP_000018262.1.99628 WP_000018262.1.99640 WP_000018262.1.99649 WP_000018262.1.99674 WP_000018262.1.99678 WP_000018262.1.99685 WP_000018262.1.99732 WP_000018262.1.99753 WP_000018262.1.9978 WP_000018262.1.99781 WP_000018262.1.99790 WP_000018262.1.99879 WP_000018262.1.99900 WP_000018262.1.99905 WP_000018262.1.99920 WP_000018262.1.99980 171101.spr1882 373153.SPD_1897 487214.SPH_2257 488221.SP70585_2177 gi|405760053|ref|YP_006700649.1| gi|387627216|ref|YP_006063392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]