SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 100226.SCO7226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO7226
Domain Number 1 Region: 82-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000248
Family NfeD domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO7226
Sequence length 146
Comment (Streptomyces coelicolor)
Sequence
MAVMDPWLIWLIVSAVLVLAEIFTLTAALGMLGVAALITAGSAAAGLSTPFQFLVFTVVS
AVTLFFLRPVALRHLVQPQTQRFGVDALVGQAAYVVSDVTGREGRVRIGGEEWTARSYDE
TLVIPRGATVDVLEISGTTAFVYPRE
Download sequence
Identical sequences Q9K459
GO.3498 gi|21225503|ref|NP_631282.1| NP_631282.1.49638 WP_011031525.1.26049 WP_011031525.1.55229 WP_011031525.1.58943 WP_011031525.1.86682 100226.SCO7226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]