SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000002891 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000002891
Domain Number 1 Region: 35-617
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.28e-161
Family Prokaryotic type I DNA topoisomerase 0.0000153
Further Details:      
 
Domain Number 2 Region: 645-688
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000255
Family PhnA zinc-binding domain 0.058
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000002891
Domain Number - Region: 971-1001
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00403
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000002891
Sequence length 1003
Comment (Mus musculus)
Sequence
MIFPVTLLAFQWHRRPGGRALSRAAMEVAFRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
KEGLSKFNKIYEFDYHLYGQNVTMIMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFIDIKKTLERETHHCQALVIWTDCDREGENIGFEIIHVCKAVKPNLRVLRARFSE
ITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEVFHKIKVTHDHKDGTVEFNWKRYRLFNHTACLVLY
QLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPKDLNLVALVEQQTVDPHWGAFAQTILERGGPTPRNGSKSDQAHPPIHPT
KYTSGLQGDDRRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLIILARNYLDV
YPYDHWSDKLLPVYEQGSHFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTSDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKK
DKFQVLRQQVQKYKQVFIEAVAKAKKLDEALSQYLGERTEMAQQEEIYPAMPEPVRKCPQ
CNKDMVLKTKKSGGFYLSCMGFPECRSAVWFPDSVLEASRDNSVCSVCQPPPVYRLKLKF
KRGSLPPAMPLEFVGCIGGCDETLKEIFGLRFPRALPRASQPSGHLQASQALNRMDSSQH
NLSQPLVNRHTRPSKTVAQALLPPTTAGESNSVTCNCGREAVLLTVRKQGPNQGRHFYKC
SNGDCNFFLWADSSHSTGGGTPTSASGPPGSSVGCPSSVGSHMDGFGSLGSDSDGGTPCL
CGQPAVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENVAPGSFAAPAWPGGRGKAQ
RPEAASKRPRAGSSDAGSTVKKPRKCSLCHQPGHTRTFCPQNR
Download sequence
Identical sequences O70157 Q5NCT2
ENSMUSP00000002891 10090.ENSMUSP00000002891 NP_033436.1.92730 ENSMUSP00000002891 ENSMUSP00000002891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]