SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000020550 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000020550
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily UBC-like 1.4e-52
Family UBC-related 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000020550
Sequence length 235
Comment (Mus musculus)
Sequence
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA
RLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEADSCFGDEEDDSGTEES
Download sequence
Identical sequences A0A1A6H8Z5 D4A453 Q8CFI2
GO.52080 ENSMUSP00000020550 ENSRNOP00000011023 ENSMUSP00000020550 ENSMUSP00000128806 10090.ENSMUSP00000020550 NP_001013121.2.100692 NP_001013121.2.4139 NP_808281.1.92730 XP_006978294.1.50099 XP_017169376.1.92730 XP_017169377.1.92730 XP_021060288.1.100879 XP_021497596.1.76796 ENSMUSP00000020550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]