SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000020681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10090.ENSMUSP00000020681
Domain Number - Region: 114-136
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0238
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000020681
Sequence length 585
Comment (Mus musculus)
Sequence
MSAAAVDPVSATPMTGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDIN
PHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSITTKYRKGAC
ENCGAMTHKRKDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMK
IVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDE
DKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANA
GKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVK
KEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYE
EDVKINNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKESVNSEECIITGATAEESV
KKPQALLELHQEKLKEEKKKKKKKKKHRKSSSDSDDEERKQEKLKKALNAEEARLLHVKE
IMQIDERKRPYNSIYETREPTEEEMEAYRMKRQRPDDPMASFLGQ
Download sequence
Identical sequences Q8BHJ9
ENSMUSP00000122142 ENSMUSP00000020681 ENSMUSP00000137281 ENSMUSP00000020681 10090.ENSMUSP00000020681 NP_683514.2.92730 NP_945174.1.92730 XP_011247125.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]