SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000020702 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000020702
Domain Number 1 Region: 206-286
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.18e-25
Family Thyroglobulin type-1 domain 0.00023
Further Details:      
 
Domain Number 2 Region: 37-120
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-21
Family Growth factor receptor domain 0.0000743
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000020702
Sequence length 292
Comment (Mus musculus)
Sequence
MHPARPALWAAALTALTLLRGPPVARAGAGAVGAGPVVRCEPCDARALSQCAPPPTAPAC
TELVREPGCGCCLTCALREGDACGVYTERCGTGLRCQPRPAEQYPLRALLNGRGFCANAS
AAGSLSTYLPSQPAPGNISESEEEHNAGSVESQVVPSTHRVTDSKFHPLHAKMDVIKKGH
ARDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPN
CDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYDTKGKDDVHCLSVQSQ
Download sequence
Identical sequences P47878
ENSMUSP00000020702 ENSMUSP00000020702 ENSMUSP00000131670 10090.ENSMUSP00000020702 ENSMUSP00000020702 NP_032369.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]