SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000021956 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000021956
Domain Number 1 Region: 164-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-67
Family Tandem AAA-ATPase domain 0.0000539
Further Details:      
 
Domain Number 2 Region: 339-566
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-52
Family Tandem AAA-ATPase domain 0.00098
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000021956
Domain Number - Region: 578-603
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000152
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000021956
Sequence length 622
Comment (Mus musculus)
Sequence
MEDSEPERKRARADEATAGGSRSEDEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGATE
EEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESV
AEGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPI
KSFKEMKFPAAILRGLKKKGILHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVI
MFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGG
MSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRT
IFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAK
MVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFRE
GKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKAC
DESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEA
MQTKQVSNIGRKDYLAHSSMDF
Download sequence
Identical sequences Q91VN6
10090.ENSMUSP00000021956 NP_598820.2.92730 ENSMUSP00000021956 ENSMUSP00000021956 ENSMUSP00000021956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]