SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000022121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000022121
Domain Number 1 Region: 179-230
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000954
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 
Domain Number 2 Region: 123-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000576
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000022121
Sequence length 271
Comment (Mus musculus)
Sequence
MTRWARVTTSNSKRPLSATSWEDMKKGSVERADQSLPNRKQCQSSRLPLRNDSPQAKRKK
NKKKKEYLNEDVNGFMEYLKQNSQVLHNGQLIAADSQEVREEIAVALKKDSRREGRRLKR
QAAKKNAMVCFHCRQPGHGIADCPAVLESQDMGTGICYRCGSTEHEMSKCRANVDPALGE
FPFAKCFVCGEMGHLSRSCPDNTKGVYADGGSCKLCGSVEHFKKDCRENQNSDRIITVGR
WAKGMSADYEDVLDVPKLQKPKTKVPKVVNF
Download sequence
Identical sequences Q8R1J3
ENSMUSP00000022121 NP_663428.2.92730 ENSMUSP00000022121 ENSMUSP00000022121 10090.ENSMUSP00000022121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]