SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000025202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000025202
Domain Number 1 Region: 186-439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-57
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily POZ domain 3.4e-33
Family Tetramerization domain of potassium channels 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000025202
Sequence length 511
Comment (Mus musculus)
Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH
PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD
SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF
EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE
TEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA
TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH
HSTQSDTCPLAQEEILEINRAGRKPLRGMSI
Download sequence
Identical sequences P15388 Q3UHB6 Q5BN35
ENSPCAP00000001209 10090.ENSMUSP00000025202 ENSMUSP00000025202 ENSTBEP00000003433 NP_032447.1.92730 XP_017206387.1.1745 ENSPCAP00000001209 ENSTBEP00000003433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]