SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000031376 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10090.ENSMUSP00000031376
Domain Number - Region: 228-250
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000398
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Domain Number - Region: 52-120
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00379
Family Mitotic arrest deficient-like 1, Mad1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000031376
Sequence length 709
Comment (Mus musculus)
Sequence
MAAGVDFGDLELFEAFDPPEESTPKPVHTRFKDDEEEEDDDDDENGVGDAELQEQLRRCE
ATIEQLRAENQELKRKLNILTRPSGILVSNTKIDGPLLQILFMNNAISKQYHQEIEEFVS
NLVKRFEEQQKNDVEKTSFSLLPQPSSVMLEEDHKVEESCAVKNNKEAFSVVGSVLYFTN
FCLDKLGQPLLNENPQLTEGWEIPKYQQVFSHIVPLEGQEMQVKAKRPKPHCFNCGSEEH
QMKECPMPRNAARISEKRKEYMDACGEASGQSFQQRYHAEEVEERFGRFKPGVISEELQD
ALGVTDKSLPPFIYRMRQLGYPPGWLKEAELENSGLALYDGNDDADGETETGEIQNKNVT
YDLSKLVNYPGFNISTPRGIPDEWRMFGSIPMQACQQKDVFASYLNSNIQSPSMRSSGKR
SSSQSSPNSPKKQRKEGSAAASPADMELDSDVEIPPGSQSSKAFQFQPPLPPGTPPPLPQ
GTPPPLFTPPLPKGTPPLTPSDSPQARPAASAMDEDALTLEELEEQQRQIWAALQQAEGG
NGDSDVPGDTPLTGNSVASSPCPNEFDLPVPEGKALEKPVLAEPQEPAASVDTAGPEPSC
SPAAGAAVLSQREEEAAAEGGPGDALLDNGGVLNMNMSNGSNQQPIHPDSRPPMAPKTHS
PVPDMSKFATGITPFEFENMAESTGMYLRIRNLLKNSPRNQQKNKKTCE
Download sequence
Identical sequences Q9CYA6
ENSMUSP00000031376 ENSMUSP00000031376 ENSMUSP00000031376 10090.ENSMUSP00000031376 NP_081770.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]