SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000031382 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000031382
Domain Number 1 Region: 182-334
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.41e-43
Family Cap-Gly domain 0.0000000867
Further Details:      
 
Domain Number 2 Region: 38-133
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.1e-34
Family Cap-Gly domain 0.00000299
Further Details:      
 
Domain Number 3 Region: 837-932
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000889
Family Myosin rod fragments 0.003
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000031382
Domain Number - Region: 1398-1432
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00698
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000031382
Sequence length 1437
Comment (Mus musculus)
Sequence
MSMLKPSGLKAPTKILKPGSTALKTPAAAAAPVEKTIPSEKASGPPSSETQEEFVDDFRV
GERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTR
PSKLTRKVQAEDEANGLQAAPGRTASPLSTAAATMVSSSPATPSNIPHKPSQSTAKEPSA
TPQISNLTKTASESISNLSEAGSVKKGERELKVGDRVLVGGTKAGVVRFLGETDFAKGEW
CGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKAAAVRRVMA
ATPASLKRSPSASSLSSMSSVASSVSSKPSRTGLLTETSSRYARKISGTTALQEALKEKQ
QHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAAD
REKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSPISEDPENTQTKLEHARTKELE
QSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRAQEVAELRRRLESSKPPGD
VDMSLSLLQEISALQEKLEAIHTDHQGEMTSLKEHFGAREEAFQKEIKALHTATEKLSKE
NESLRSKLDHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGIGTDSAEFAELKT
QIERLRLDYQHEIESLQSKQDSERSAHAKEMETMQAKLMKIIKEKEDSLEAVKARLDSAE
DQHLVEMEDTLNKLQEAEIKVKELEVLQAKYTEQSEVIGNFTSQLSAVKEKLLDLDALRK
ANSEGKLELETLRQQLEGAEKQIKNLETERNAESSKANSITKELQEKELVLTGLQDSLNQ
VNQVKETLEKELQTLKEKFASTSEEAVSAQTRMQDTVNKLHQKEEQFNVLSSELEKLREN
LTDMEAKFKEKDDREDQLVKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERSVEEL
QLKLTKANENASFLQKSIGEVTLKAEQSQQQAARKHEEEKKELEEKLLELEKKMETSYNQ
CQDLKAKYEKASSETKTKHEEILQNLQKMLADTEDKLKAAQEANRDLMQDMEELKTQADK
AKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNARLQNELDTLKENNLKTVEELNKSK
ELLSVENQKMEEFKKEIETLKQAAAQKSQQLSALQEENVKLAEELGRTRDEVTSHQKLEE
ERSVLNNQLLEMKKRESEFRKDADEEKASLQKSISLTSALLTEKDAELEKLRNEVTVLRG
ENATAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDAQAEEDERAQES
QIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGEDLNSYDSDDQEKQSKKKPRLFCDI
CDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRSEERPYCEICEMFGHWATNCNDDETF
Download sequence
Identical sequences F8WIA1
ENSMUSP00000115965 ENSMUSP00000031382 XP_006530484.1.92730 ENSMUSP00000031382 10090.ENSMUSP00000031382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]