SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000035616 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10090.ENSMUSP00000035616
Domain Number - Region: 523-572,1044-1114
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0306
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000035616
Sequence length 1130
Comment (Mus musculus)
Sequence
MGKLIRMGTQERRLLRPKRLHWSRLLFLLGMLIIGSTYQHLRRPQNPPSMWTKVSSQQPI
KLAVRDLPNNEMAVAGSDPPEASSEVEDGMLAAQDTVIMDEAAPSIAMEDTPNPPRTTKI
PPASLKNSYSPTTAGTRRQKENIPPTPSGAPSHFISTPGRQRVKSYIPKPRGERKNSSPT
HAREKGRTHTPSPAGAHTISPTATVRDRETMATYRLLETRFERTAGETTAASLKRMVLNT
PTFLTHEVETNLMTSSSLVGKNTAVSLRKGERNISTTPQGAVPQHTPATSEEQMTVSTRM
GSIPATIEGSTAARRINNPLSRTSAPAIRIASATNREKRPSTAPSTLVTPKATMSTQVHR
CVVVEPAPAVPMTPSPGVTSILFPETPSSGPSALPPGWPNLHPKAEYPPDLFSVEDRRQG
WVVLHIFGMMYVFVALAIVCDEYFVPALGVITHKLQISEDVAGATFMAAGGSAPELFTSL
IGVFISHSNVGIGTIVGSAVFNILFVIGTCALFSREILNLTWWPLFRDVSFYILDLSMLI
VFFLDSFIAWWESLLLLLAYALYVFTMKWNKQIELWVKEQLSRRPVAKVMALGDLSKPSE
DAVEENEQQDSKKLKLPSVLTRGSSSASLHNSIIRNTIYHLMLHSLDPLGEARPSKDKQE
SLNQEARVLSQTKAESSPDEDEPAELPAVTVTPAPAPDAKGDQEDDPGCQEDVDEAERRG
EMTGEEGEKETETEGKKDEQEGETEAERKEDEQEEETEAEGKEQEGETEAEGKEDEQEGE
TEAEGKKDEQEGETEAEGKEEQEGETEAEGKEDEQEGETEAEGKEEQEGETEAESKEVEQ
ERETEAEGKDKHEGQGETQPDDTEVKDGEGETEANAEDQCEATQGEKGADGGGESDGGDS
EEEEDEEDEEEEEEEDEEEEEEENEEPLSLEWPDSRQKQAIYLFLLPIVFPLWLTIPDVR
RQESRKFFVITFLGSIIWIAMFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLIT
SVIVARKGLGDMAVSSSVGSNIFDITVGLPVPWLLFSLINALQPVPVSSNGLFCAIVLLF
LMLLFVIFSIASCKWRMNKILGFTMFLLYFVFLVISVMLEDRIISCPVSV
Download sequence
Identical sequences Q91WD8
ENSMUSP00000035616 ENSMUSP00000035616 10090.ENSMUSP00000035616 NP_659062.1.92730 XP_017168760.1.92730 ENSMUSP00000035616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]