SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000035808 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000035808
Domain Number 1 Region: 93-162
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.8e-17
Family Ubiquitin-related 0.0068
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000507
Family Ubiquitin-related 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000035808
Sequence length 162
Comment (Mus musculus)
Sequence
MASVRTCVVRSDQWRLMTFETTENDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRKL
SSYGIDKETTIHLTLKVVKPSDEELPLFLVESKNEGQRHLLRVRRSSSVAQVKEMIESVT
SVIPKKQVVNCNGKKLEDGKIMADYNIKSGSLLFLTTHCTGG
Download sequence
Identical sequences P63072
GO.35528 MmR42 10090.ENSMUSP00000035808 NP_075626.1.92730 ENSMUSP00000035808 ENSMUSP00000035808 ENSMUSP00000035808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]