SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000038256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000038256
Domain Number 1 Region: 76-170
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.9e-25
Family Canonical RBD 0.016
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-21
Family Canonical RBD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000038256
Sequence length 357
Comment (Mus musculus)
Sequence
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRT
GRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAAAAAASA
YNYAEQTMSHLPQVQSSAVPSHLNSTSVDPYDRHLLQNSGSAATSAAMAAAASSSYYGRD
RSPLRRNAAVLPAVGEGYGYGPESEMSQASAATRNSLYDMARYEREQYVDRTRYSAF
Download sequence
Identical sequences Q8VE92
ENSMUSP00000038256 ENSMUSP00000038256 NP_079993.2.92730 XP_006531886.1.92730 XP_006531887.1.92730 XP_006531888.1.92730 XP_006531889.1.92730 10090.ENSMUSP00000038256 ENSMUSP00000038256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]