SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000049528 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000049528
Domain Number 1 Region: 242-329
Classification Level Classification E-value
Superfamily RING/U-box 1.19e-20
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Domain Number 2 Region: 155-180
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000772
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000049528
Sequence length 1790
Comment (Mus musculus)
Sequence
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADSDLQITNAQTKEEYTDD
NALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPVMGTTKAIDDASASISLAQLTKTANL
AEANASEEDKIKAMMSQSGHEYDPINYMKKTLVGPPPPSYTCFRCGKPGHYIKNCPTNGD
KNFESGPRIKKSTGIPRSFMMEVKDPNMKGAMLTNTGKYAIPTIDAEAYAIGKKEKPPFL
PEEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTC
HQNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQLPPPPPPVPPPRPLMQRNLQPLMR
SPISRQQDPLMIPVTSSSAHSAPSISSLTSNPSALAPSVSGNPSSAPAPVPDITATVSIS
VHSEKSDGPFRDSDNKLLPAAALTSEHSKGASSIAITALMEEKGYQVPVLGTPSLLGQSL
LHGQLIPTTGPVRINAARPGGGRPGWEHSNKLGYLVSPPQQIRRGERSCYRSINRGRHHS
ERSQRTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYSV
PPPGFPPAPANISTPWVSSGVQTAHSNTIPTTQAPPLSREEFYREQRRLKEEEKKKSKLD
EFTNDFAKELMEYKKIQKERRRSFSRSKSPYSGSSYSRSSYTYSKSRSGSTRSRSYSRSF
SRSHSRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQ
SPTKRNVPQGETEREYFNRYREVPPPYDIKAYYGRSVDFRDPFEKERYREWERKYREWYE
KYYKGYAVGAQPRPSANREDFSPERLLPLNIRNSPFTRGRREDYAAGQSHRNRNLGGNYP
EKLSTRDSHNAKDNPKSKEKESENVPGDGKGNKHKKHRKRRKGEESESFLNPELLETSRK
CRESSGIDETKTDTLFVLPSRDDATPVRDEPMDAESITFKSVSDKDKREKDKPKVKSDKT
KRKSDGSATAKKDNVLKPSKGPQEKVDGDREKSPRSEPPLKKAKEEATKIDSVKPSSSSQ
KDEKVTGTPRKAHSKSAKEHQEAKPAKDEKVKKDCSKDIKSEKPASKDEKAKKPEKNKLL
DSKGEKRKRKTEEKSVDKDFESSSMKISKVEGTEIVKPSPKRKMEGDVEKLERTPEKDKI
ASSTTPAKKIKLNRETGKKIGNAENASTTKEPSEKLESTSSKIKQEKVKGKAKRKVAGSE
GSSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQS
KWDKDDFESEEEDVKTTQPIQSVGKPSSIIKNVTTKPSATAKYTEKESEQPEKLQKLPKE
ASHELMQHELRSSKGSASSEKGRAKDREHSGSEKDNPDKRKSGAQPDKESTVDRLSEQGH
FKTLSQSSKETRTSEKHESVRGSSNKDFTPGRDKKVDYDSRDYSSSKRRDERGELARRKD
SPPRGKESLSGQKSKLREERDLPKKGAESKKSNSSPPRDKKPHDHKAPYETKRPCEETKP
VDKNSGKEREKHAAEARNGKESSGGKLPCIPNPPDPPMEKELAAGQVEKSAVKPKPQLSH
SSRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEEAVASISKDLKEKTTEKAKESLTVA
TASQPGADRSQSQSSPSVSPSRSHSPSGSQTRSHSSSASSAGSQDSKKKKKKKEKKKHKK
HKKHKKHKKHAGADGDVEKSQKHKHKKKKAKKNKDKEKEKDDQKVRSVTV
Download sequence
Identical sequences P97868
NP_035377.2.92730 ENSMUSP00000049528 10090.ENSMUSP00000049528 ENSMUSP00000071519 ENSMUSP00000049528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]