SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000049668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000049668
Domain Number 1 Region: 94-184
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000509
Family Calbindin D9K 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000049668
Sequence length 203
Comment (Mus musculus)
Sequence
MPSSLHAPLSGEVSAFSLSCPYFRCQDSTGEDLGRFPSPLPFLMCLLLFFPFRARWPRLM
SSEKPGESPKPQKMAQPGGSQKKETSRSVPVTDPTSHNSEINQRDQQFSDMHLADLQKVF
EKEADENGALKKEGFIRIMKGVLSSMSEEMLELLFLKVDSDCNGFVTWQKYVDYMMREFQ
GKEEMRKSQYRLRFHLPMTVIPL
Download sequence
Identical sequences Q8C9R9
ENSMUSP00000135811 10090.ENSMUSP00000049668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]