SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000050488 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000050488
Domain Number 1 Region: 41-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000269
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 
Domain Number 2 Region: 132-177
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000785
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000050488
Sequence length 209
Comment (Mus musculus)
Sequence
MGSVSNQQFAGGCAKAAEKAPEEAPPDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS
ERRPKGKNMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQQ
GPSSQGKPAYFREEEEEIHSPALLPEAQN
Download sequence
Identical sequences Q8K3Y3
ENSMUSP00000050488 ENSMUSP00000050488 10090.ENSMUSP00000050488 ENSMUSP00000050488 NP_665832.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]